crppa

D-ribitol-5-phosphate cytidylyltransferase

462 amino acids

Cytidylyltransferase required for protein O-linked mannosylation (PubMed:22522421). Catalyzes the formation of CDP-ribitol nucleotide sugar from D-ribitol 5-phosphate (By similarity). CDP-ribitol is a substrate of FKTN during the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity (By similarity). Shows activity toward other pentose phosphate sugars and mediates formation of CDP-ribulose or CDP-ribose using CTP and ribulose-5-phosphate or ribose-5-phosphate, respectively (By similarity). Not Involved in dolichol production (By similarity).

Belongs to the IspD/TarI cytidylyltransferase family. IspD subfamily.

52.064 kDa

MGTVTIQLSCLRHIRKLCFSCPWEGRRLFKMLLQFHHETQRPLDPGCLLPQDAERSADQPGRAVVDFPVAAVLPAGGSGERMGLTTPKQFCSIFNRPLISYTIQAFERLPWIVMVVVVVAKDNHDLMLNIVRKFNHTKVKVVHGGTTRHRSIYNGLQAFSDSTDSSTPKPKVVIIHDAVRPFVEEDLLLKITLAAKEQGASGAIRPLVSTVIATTSESYLDHSLERAKYRASEMPQGFLYDIIFQAYQRCSEFDLEFGTECLHLALQYCGTNARLIEGPPTLWKVTYKRDLAAAEAIIKETLSVSACIIAEAEEEAVELAKTLQKNLNMMETDVIPCGKESNVQYLSKTRNFIHISASASSSLWVLEMVKCFEDIDHARLYPVVIVWVQLSMTKQSADSQETDEFMALASEVKQRNVLLYGIKIDHSKELEQWQRSLERLGQITLVLIRDRNMALTGQMLHV

CRPPA

D-ribitol-5-phosphate cytidylyltransferase

451 amino acids

Cytidylyltransferase required for protein O-linked mannosylation (PubMed:22522420, PubMed:27130732, PubMed:27601598, PubMed:26687144, PubMed:22522421, PubMed:26923585). Catalyzes the formation of CDP-ribitol nucleotide sugar from D-ribitol 5-phosphate (PubMed:27130732, PubMed:26687144, PubMed:26923585). CDP-ribitol is a substrate of FKTN during the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity (PubMed:27130732, PubMed:26687144, PubMed:26923585). Shows activity toward other pentose phosphate sugars and mediates formation of CDP-ribulose or CDP-ribose using CTP and ribulose-5-phosphate or ribose-5-phosphate, respectively (PubMed:26687144). Not Involved in dolichol production (PubMed:26687144).

Belongs to the IspD/TarI cytidylyltransferase family. IspD subfamily.

49.873 kDa

MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAVLPAGGCGERMGVPTPKQFCPILERPLISYTLQALERVCWIKDIVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAEDQINSKLSKPEVVIIHDAVRPFVEEGVLLKVVTAAKEHGAAGAIRPLVSTVVSPSADGCLDYSLERARHRASEMPQAFLFDVIYEAYQQCSDYDLEFGTECLQLALKYCCTKAKLVEGSPDLWKVTYKRDLYAAESIIKERISQEICVVMDTEEDNKHVGHLLEEVLKSELNHVKVTSEALGHAGRHLQQIILDQCYNFVCVNVTTSDFQETQKLLSMLEESSLCILYPVVVVSVHFLDFKLVPPSQKMENLMQIREFAKEVKERNILLYGLLISYPQDDQKLQESLRQGAIIIASLIKERNSGLIGQLLIA

Crppa

D-ribitol-5-phosphate cytidylyltransferase

447 amino acids

Cytidylyltransferase required for protein O-linked mannosylation (By similarity). Catalyzes the formation of CDP-ribitol nucleotide sugar from D-ribitol 5-phosphate (By similarity). CDP-ribitol is a substrate of FKTN during the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity (By similarity). Shows activity toward other pentose phosphate sugars and mediates formation of CDP-ribulose or CDP-ribose using CTP and ribulose-5-phosphate or ribose-5-phosphate, respectively (By similarity). Not Involved in dolichol production (By similarity).

Belongs to the IspD/TarI cytidylyltransferase family. IspD subfamily.

49.136 kDa

MEPGPCSRPAEPGHCVSGPAGAGSAFPESPLSVAGAEPGNRPGTVAAVLPAGGCGERMGVRTPKQFCRVLERPLISYTLQAMERVCWIKDIVVTVTGENMEAMRSIIQRYGHKRISLAEAGATRHRSIFNGLKALAEDQPDCKLTKPEVVIIHDAVRPFVEEDILLRVVLAAKEHGAAGAIRPLVSTVISPSADGHLDHSLDRAKHRASEMPQAFLFDVIYEAYQQCSDFDLEFGTECLQLALKYCHRKAKLVEGPPALWKVTYKQDLCAAEAMIKEKISQEICVVMNTKDEESVGHLLEEALRKELNCMKITSTVMDHIGGDIRNFIEQCYSFICVNVVSPDSQETRKLLRILEESSLPLLYPVVVVLVHCFDFTSVPLAQKMESLVWIRGLAKEVKERNILLSGLLLNYSQDEQKLQESLGQSAAIIAALVKERNSALVGQLLVA

Crppa

D-ribitol-5-phosphate cytidylyltransferase

447 amino acids

Cytidylyltransferase required for protein O-linked mannosylation (By similarity). Catalyzes the formation of CDP-ribitol nucleotide sugar from D-ribitol 5-phosphate. CDP-ribitol is a substrate of FKTN during the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity (By similarity). Shows activity toward other pentose phosphate sugars and mediates formation of CDP-ribulose or CDP-ribose using CTP and ribulose-5-phosphate or ribose-5-phosphate, respectively (By similarity). Not Involved in dolichol production (By similarity).

Belongs to the IspD/TarI cytidylyltransferase family. IspD subfamily.

49.192 kDa

MESGPCSRPAEPRHCVSGRAGAGLAFPAFPLSAAGAEPGSRIGTVAAVLPAGGCGERMGVRTPKQFCRVLERPLISYTLQAMERVCWIKDIVVTVTGENMEAMRSIIQRYGHKRISLAEAGATRHRSIFNGLKALAEDQPGCELTRPEVVIIHDAVRPFVEEDILLRVVLAAKEHGAAGAIRPLVSTVVSPSADGHLDHSLDRAKHRASEMPQAFHFDVIYEAYQKCSDFDLEFGTECLQLALKYCHRKAKLVEGTPDLWKVTYKQDLCAAEAMIKEKISQEICVVVNTKDEESVGHLLEEVLRNELNCIKVTSTVLDRTSGDIENFIDQCYSFICVNVVSSESRETRKLLSILEESSLPLLYPVVVVLVHCFDFTVVPLAQKMENLVWIRELAKEAKGRNVLLSGVLLNHSQDEQKLQESLVQSAAIIAALVKERNSALVGQLLVA

CRPPA

D-ribitol-5-phosphate cytidylyltransferase

445 amino acids

Cytidylyltransferase required for protein O-linked mannosylation (By similarity). Catalyzes the formation of CDP-ribitol nucleotide sugar from D-ribitol 5-phosphate (By similarity). CDP-ribitol is a substrate of FKTN during the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity (By similarity). Shows activity toward other pentose phosphate sugars and mediates formation of CDP-ribulose or CDP-ribose using CTP and ribulose-5-phosphate or ribose-5-phosphate, respectively. Not Involved in dolichol production (By similarity).

Belongs to the IspD/TarI cytidylyltransferase family. IspD subfamily.

49.51 kDa

MELGPPGGSGPAEPGPRLRGLRGADAAASASSLSRFGAEAGCRASAVAAVLPAGGSGERMGVPTPKQFCPILERPLISYTLQALERVSWIKDIIVAVTRENMETMKGIIQRYQHKRISLVEAGVTRHRSIFNGLKALAEDQPNCRLSKPEVVIIHDAVRPFVEEDVLLKVVTAAQEHGASGAIRPLVSTVISPSADSCLDHSLERARYRASEMPQAFLFDVIYDAYQQCSDYDLEFGTECLHLALKYSHIKAKLVEGSPDLWKVTYKRDLYAAESIIKERISQKVCVVMDTKEDEEHVGHCLEEMLKTELNHVKVTSGQDLQQIILEQCYNFVCVNVMTSDFEETQRLLNMVEESNLSILYPVVVISVHFLDYESVPLGQKMEKVMQIREFAKEAKKRNILLSGLLIYFPQEEQKLRESLRQGTTIISALIKERNSGLIGQLLVA

crppa

D-ribitol-5-phosphate cytidylyltransferase

411 amino acids

Cytidylyltransferase required for protein O-linked mannosylation (By similarity). Catalyzes the formation of CDP-ribitol nucleotide sugar from D-ribitol 5-phosphate. CDP-ribitol is a substrate of FKTN during the biosynthesis of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity (By similarity). Shows activity toward other pentose phosphate sugars and mediates formation of CDP-ribulose or CDP-ribose using CTP and ribulose-5-phosphate or ribose-5-phosphate, respectively (By similarity). Not Involved in dolichol production (By similarity).

Belongs to the IspD/TarI cytidylyltransferase family. IspD subfamily.

45.558 kDa

MDDAAKDLGRCAVVLPAGGCGERLGSLTPKQFCTVLGRPLISHTLEAFERASWIKDIIVVVASESLDLMKAIIHKYGHQRVTLVKGGETRHRSIFNGLKVFSENHSDDTAIDKPEVVIIHDAVRPFVDEDFLLQVAKSAKQHGAAGAIRPLVSTVIASSSDGFLDYSLERARHRASEMPQAFQYDVIYRAYLQCTDYDLDFGTECLHLALQYSNVKAKLLEGPPDLWKVTYKRDLYAAESVIKESISQQLCIVTNVKKEAIEVGFLLHENLKLHYKVKAVSSSMCKTIHHLQNIFHGQCCNFICINVKDLDFEETQNLVDLLQTTNASISYPLVIVSVHLTTEDSSSGNKLSGVRKLAKEAHKSNILVYGLLINIDQDKVQLQQTVCEGTAIITALIKDRNPALVGQLMVA