About Products Protein Database Contact

CYP82Y1

Gene
CYP82Y1
Protein
(S)-N-methylcanadine 1-hydroxylase CYP82Y1
Organism
Papaver somniferum
Length
556 amino acids
Function
Cytochrome P450 involved in the biosynthesis of the benzylisoquinoline alkaloid noscapine (PubMed:24324259, PubMed:27378283, PubMed:29610307). Converts (S)-N-methylcanadine to (S)-1-hydroxy-N-methylcanadine (PubMed:24324259, PubMed:27378283).
Similarity
Belongs to the cytochrome P450 family.
Mass
62.928 kDa
Sequence
MAYLMIKKSIYLFFDQPTAVGTLILAFLLTLSPVIIYYEQKKRGLRRNRTAITTTPLPEASGAWPVIGHLLLFMNENDLNHVTLGHMADKYGPIFSLRFGRHRTLVVSSWEMVKECFTGTNDKLFSNRPSSLAVKLMFYDTESYGFAPYGKYWRELRKISTHKLLSNQQLEKFKHLRISEVDNSFKKLHELCSNNKQGGDTTYVASLVRMDDWFAYLTFNVIGRIVSGFQSNAVAGATNSQEKYKLAIDEVSNLMATFAVSDVVPRLGWIDRLTGLTGKMKNCGKKLDAVVGDAVEDHRQKKLKISRNNTGALTEHEEEDFIDVCLSIMEQSQIPGNHPEISVKSIALDMLSGGSDTTKLIMTWTLSLLLNHPDILDKAKEEVDTYFGKKKISDNTPVVDAADVPNLVYIQAIIKESMRLYPASTLMERMTSDDCDVGGFHVPAGTRLWVNVWKMQRDPRVWKDPLVFLPERFLSNDKGMVDVKGQNYELIPFGTGRRICPGASFALEVLHLVLTRLILEFEMKAPEGKIDMRARPGFFHNKVVPLDVQLTPRTLD