About Products Protein Database Contact

CYP716A15

Gene
CYP716A15
Protein
Beta-amyrin 28-monooxygenase
Organism
Vitis vinifera
Length
480 amino acids
Function
Catalyzes the carboxylation of beta-amyrin at the C-28 position to form oleanolic acid. Catalyzes the carboxylation of alpha-amyrin and lupeol at the C-28 position to form ursolic acid and betulinic acid respectively. May be involved in saponin biosynthesis in fruit skin.
Similarity
Belongs to the cytochrome P450 family.
Mass
54.651 kDa
Sequence
MEVFFLSLLLIFVLSVSIGLHLLFYKHRSHFTGPNLPPGKIGWPMVGESLEFLSTGWKGHPEKFIFDRISKYSSEVFKTSLLGEPAAVFAGAAGNKFLFSNENKLVHAWWPSSVDKVFPSSTQTSSKEEAKKMRKLLPQFFKPEALQRYIGIMDHIAQRHFADSWDNRDEVIVFPLAKRFTFWLACRLFMSIEDPAHVAKFEKPFHVLASGLITVPIDLPGTPFHRAIKASNFIRKELRAIIKQRKIDLAEGKASQNQDILSHMLLATDEDGCHMNEMEIADKILGLLIGGHDTASAAITFLIKYMAELPHIYEKVYEEQMEIANSKAPGELLNWDDVQKMRYSWNVACEVMRLAPPLQGAFREAITDFVFNGFSIPKGWKLYWSANSTHKSPECFPQPENFDPTRFEGDGPAPYTFVPFGGGPRMCPGKEYARLEILVFMHNVVKRFKWDKLLPDEKIIVDPMPMPAKGLPVRLHPRKP