CXCL3

C-X-C motif chemokine 3

107 amino acids

Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.

Belongs to the intercrine alpha (chemokine CxC) family.

11.342 kDa

MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Cxcl3

C-X-C motif chemokine 3

101 amino acids

Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Belongs to the intercrine alpha (chemokine CxC) family.

11.109 kDa

MAPPTRRLLNAALLLLLLLMATSHQPSGTVVARELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKSS

Cxcl3

C-X-C motif chemokine 3

100 amino acids

Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Belongs to the intercrine alpha (chemokine CxC) family.

10.686 kDa

MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS