CXCL11

C-X-C motif chemokine 11

100 amino acids

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses (By similarity).

Belongs to the intercrine alpha (chemokine CxC) family.

10.943 kDa

MSVKGMAIVLTVILCAAIVQGFPMFKGGRCLCIGPGVKAVKVADIEKVSIIYPTNNCDKTEVIITLKTHKGQRCLNPKAKQAKAIIKKVQRKNSEKYKNI

Cxcl11

C-X-C motif chemokine 11

100 amino acids

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses (By similarity).

Belongs to the intercrine alpha (chemokine CxC) family.

11.266 kDa

MNRKVTAIALAAIIWATAAQGFLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

CXCL11

C-X-C motif chemokine 11

100 amino acids

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses (By similarity).

Belongs to the intercrine alpha (chemokine CxC) family.

10.943 kDa

MSVKGMAIVLTVILCAAIVQGFPMFKGGRCLCIGPGVKAVKVADIEKVSIIYPTNNCDKTEVIITLKTHKGQRCLNPKAKQAKAIIKKVQRKNSEKYKNI

Cxcl11

C-X-C motif chemokine 11

100 amino acids

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses (By similarity).

Belongs to the intercrine alpha (chemokine CxC) family.

11.266 kDa

MNRKVTAIALAAIIWATAAQGFLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

CXCL11

C-X-C motif chemokine 11

94 amino acids

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.

Belongs to the intercrine alpha (chemokine CxC) family.

10.365 kDa

MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

CXCL11

C-X-C motif chemokine 11

94 amino acids

Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.

Belongs to the intercrine alpha (chemokine CxC) family.

10.365 kDa

MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF