CSN4

COP9 signalosome complex subunit 4

407 amino acids

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. The CSN complex plays an essential role in oogenesis and embryogenesis and is required for proper photoreceptor R cell differentiation and promote lamina glial cell migration or axon targeting. It also promotes Ubl-dependent degradation of cyclin E (CycE) during early oogenesis.

Belongs to the CSN4 family.

46.473 kDa

MAANYGISTAALRSQLMGLINFTGTHKDQADKYRQLLKTVLTNTGQELIDGLRLFVEAIVNEHVSLVISRQILNDVGSELSKLPDDLSKMLSHFTLEKVNPRVISFEEQVAGIRFHLANIYERNQQWRDAATVLVGIPLETGQKQYSVECKLGTYLKIARLYLEDNDSVQAELFINRASLLQAETNSEELQVLYKVCYARVLDYRRKFIEAAQRYNELSYRKIVDQGERMTALKKALICTVLASAGQQRSRMLATLFKDERCQHLPAYGILEKMYLERIIRRSELQEFEALLQDHQKAATSDGSSILDRAVFEHNLLSASKLYNNITFEELGALLDIPAVKAEKIASQMITEGRMNGHIDQISAIVHFENRELLPQWDRQIQSLCYQVNSIIEKISVAEPDWMDNLN

CSN4

COP9 signalosome complex subunit 4

397 amino acids

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes. The complex is also required for degradation of IAA6 by regulating the activity of the Ubl ligase SCF-TIR complex.

Belongs to the CSN4 family.

44.957 kDa

MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQSFAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLSGIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYKVCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRRPEIDAFSEELRPHQKASLPDKSTVLDRAMIEHNLLSASKLYTNIRFDELGTLLAIDPRKAEKIAANMIGQDRMRGSIDQEEAVIHFEDDVEELQQWDQQISGLCQALNDILDGMAKKGMSVPV

csn4

COP9 signalosome complex subunit 4

393 amino acids

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity.

Belongs to the CSN4 family.

45.383 kDa

MDVNNLKQILEETSALSDHKTKTEKYKSILQQLVESKQVAPLKVFITHLTDESTPLVISRTILLSFTSSHKTLPEDIQMELGIFVLDRIQNRVVAFEEQVSEIRYNLAKLYERQENWRESARCLIAIPLDSSQRVISPEYKVKIYVKIARLFLEEEESGQAETYINRASDSLHLVKNQKLILAHKTCFARIMDYKRMFLKASLRYYDLSQCLPKDTERMHALSCAIVCAILDKAGPQRSRTLATLYKDERSQQLGVYTFLEKMFLERILKKTEVKKFAEQLKPHQMALLSDGNTVLDRAVIEHNLLSASKLYNNITFDELGSLLEIQAEKAEKVASKMVCEERLIGSIDQIERLIQFENVGDSLTQWDKKIEGLCIHMNNIIESISKYPEFIV

csn4

COP9 signalosome complex subunit 4

377 amino acids

Component of the COP9 signalosome (CSN) complex that acts as an regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunit of SCF-type E3 ubiquitin-protein ligase complexes.

Belongs to the CSN4 family.

43.063 kDa

MEEVVHYFLEGNMPVAQFREALALHYTNEKELFEQAKRCLNICCGSNNFAKRNDVLFSLLDVAVSISSLELRKELISELYVPVQSLEEAPSEYLVSCCLQLATIYEAEQNFELLCSSLEAVEKHGHFENDLEQLLLLRIRLGDAYLKLGKAEKAILTVRTSIPLAFKVSNDQLLMELQLCNARALDETGQFLEAAKCYYRVLQYKVPGNELIYRENLCSVAQCLLLAIPSPIVLQFLQEISLQPSVREIPFYSLVEKYLKRKFIGKEDGAFLLPFLLPHQVIHMNRLIEDGRHFLETNILFLSEFFEVSSTSILAKHFKLSEEQVDTVVADMVIQERLNASIDQCEGYITFLPEYGKANNLPNYVNKIATVLQHYGS

CSN4

COP9 signalosome complex subunit 4

45 amino acids

Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. It is involved in repression of photomorphogenesis in darkness by regulating the activity of COP1-containing Ubl ligase complexes (By similarity).

Belongs to the CSN4 family.

5.227 kDa

multiple

KRKFLDAALRYYSISQIEKKAYLPDKSTVLDRAMIEHNNLLSASK