COX7A2L

Cytochrome c oxidase subunit 7A-related protein, mitochondrial

114 amino acids

Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).

Belongs to the cytochrome c oxidase VIIa family.

12.544 kDa

MYYKFSGFTQKLAGAWASDAYSPQGLRPVVSTEAPPIIFATPTKLSSGPTAYDYAGKNTVPELQKFFQKSDGVPIHLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPRNK

COX7A2L

Cytochrome c oxidase subunit 7A-related protein, mitochondrial

114 amino acids

Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).

Belongs to the cytochrome c oxidase VIIa family.

12.615 kDa

MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

Cox7a2l

Cytochrome c oxidase subunit 7A-related protein, mitochondrial

111 amino acids

Involved in the regulation of oxidative phosphorylation and energy metabolism (PubMed:23857330, PubMed:23812712). Necessary for the assembly of mitochondrial respiratory supercomplex (PubMed:23857330, PubMed:23812712).

Belongs to the cytochrome c oxidase VIIa family.

12.399 kDa

MYYKFSSFTQKLAGAWASEAYTPQGLKPVSTEAPPIIFATPTKLTSSVTAYDYSGKNKVPELQKFFQKADGFHLKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPRNK