COX2

Cytochrome P450 monooxygenase COX2

526 amino acids

Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of alpha-cuprenene and oxidized derivatives (PubMed:19400802). The alpha-cuprenene synthase COP6 is the only sesquiterpene synthase identified in C.cinereus that appears to be part of a biosynthetic gene cluster and is highly specific since it catalyzes the cyclization of (2E,6E)-farnesyl diphosphate into only one product, alpha-cuprenene (PubMed:19400802, PubMed:20419721). The cytochrome P450 monooxygenase COX2 then oxidizes the cyclohexadiene ring of alpha-cuprenene at positions 1 and 4, yielding first alha-cuparene, followed by alpha-cuparophenol and a further yet unidentified compound resulting from one additional oxidation step (PubMed:19400802). The cytochrome P450 monooxygenase COX1 then likely catalyzes the oxidation at position 9 of the pentane ring of alpha-cuprenene to give the corresponding hydroxy or ketone derivatives (PubMed:19400802).

Belongs to the cytochrome P450 family.

59.361 kDa

MNIVNSLDLSNITTNHVAAAVCAGIAVYAIVAGRNRGKKYPPGPKGHPLIGSLFEMPIQNAHVVYKEWAKTYGDMIFFKVLGQPFLILSSEETITDLLDKRSTIYSSRPRMPMVVELMGWDYTLGLLPYGERWRFLRREFHRFMSPTAVSNYRQIQENSVYTFLNNLVESPEQFSKHLRLFYGSISMKVSYGINVKSAEDQYLLDAEGAMSGFMEAGIPGRFWVDLFPALKYVPSWMPGAEFKRKAARWARLNDISLERPFKHVLDQLKKGVASQSVSATLIEELPDQNSPDRKEKETIARNISATTFLAGIDTIHSTTQAFFYAMAQFPEVQKKAQAEIDAVVGDKRLPTFEDRDQLPYVNALVKELIRWSEVAPLGIYHSTTEDDEYKGYFIPKGTIVMTNAWSILTDPVTYPDPFAFKPERYLKNGVMNPDAPRPEDLAFGRGRRICPGRYLADETLFMTSVGVLAGFNISPPLDKSGKPIKLKNERVGTITLTPPKFECRIEPRSPAIRTMIHDTAESISAL

COX2

Cytochrome c oxidase subunit 2, mitochondrial

394 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

44.333 kDa

single

ILCPLEAFIVQHILTISVMGLLSCFRSTVLRKCSKGSSGMSRFLYTNNFQRNLISSGGNESYYGYFNRRSYTSLYMGTGTVGGITSARIRVPNVGCEGFMCSSHLSITQRNSRLIHSTSKIVPNSEIQNITTEMVKTPEVSRWMDQVIPTIAPCDAAEPWQLGFQDAATPIMQGIIDLHHDIFFFVIQIGVFVSWVLLRALWHFRSKMNPIPQRIVHGTTIEILWTIFPSVILMFIAIPSFALLYSMDDIVVDPAITIKAIGHQWYWTYEYSDYNNSDEQSLAFDSYMIPEDDLELGQLRLLEVDNRVVVPAKTHLRVIITSADVLHSWAVPSLGVKCDAVPGRLNQISTFIQREGVYYGQCSEICGTNHAFMPIVIEAVSTKDYGSWVSSQVN

COX2

Cytochrome c oxidase subunit 2, mitochondrial

376 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

42.222 kDa

single

STVVGKCCKGNFGMSRFLLSNDFQRKLIVSGKESYYDHFSKRSYSSPSKAPGTESTITSTKIKMPNIGSEGFAFSSFLSTVNKNSRMINFSSCLKTPVKPEQIAANPVILKMTTELEKIPRALRWMCGGFPAIALCDAPEPWQLGFQDAATPIMQGIMDLHHDIFFFLVQILVFVLWVLSRALWCFRSKISPIPQRIVHGTTIEILWTILPSIILMFIAIPSFTLLYSMDDVVVDPAITIKAIGHQWYWSYEYSDYNNSDEQSLAFDSYMVPEDDLELGQLRLLEVDNRVVVPAKTHLRVLITSADVLHSWAVPSLGVKCDAVPGRLNQISTFIQREGVYYGQCSEICGTNHAFMPIVVEAVSTKDYGSWVSNQIQ

COX2

Cytochrome c oxidase subunit 2

266 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

30.491 kDa

MTITNYINNQFTFLDMAEPWQLGFQDPATPVMEGIINFHHDLMFFLISIVVFVCWMLFRVITLFDEKKNKIPATVVHGATIEIIWTSIPALILLTVAVPSFALLYSMDEVIDPIITLKVIGSQWYWSYEYSDNLEFSDEPLIFDSYMIQEDDLAIGQFRILEVDNRVVVPTNSHIRVLITASDVLHSWAIPSLGIKLDACPGRLNQTSMFIKREGVFYGQCSEICGVNHGFMPIVVEAVSLEDYLTWLKNKINFDFNVXLIKFYGI

COX2

Cytochrome c oxidase subunit 2

262 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

29.859 kDa

MIRLDVPTPWGIRLQDSATPNAEGIHELYDHIMFYLCLILGLVSYILYVIIKDYKDNRFAYKYVRHGQVIEIIWTIFPAVILLLIAFPSFILLYLCDEVLTPAMTIKVIGLQWYWKYEYSDFVDSIGETIEFESYVIPDDMLEPGALRLLDTDTSIVVPVDTHIRFVVTANDVIHSFTIPSLGMKIDATPGRLNQVSALIQRTGVYYGQCSELCGVNHGMMPIKLECVSIEDFIEWLGENEVSLNSSMVEQCTVNALILVQF

COX2

Cytochrome c oxidase subunit 2

261 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.301 kDa

MSFTGIFHFFTNSPCDAAEPWQLGSQDAATPMMQGIIDLHHDIFFFLILILVFVSRILVRALWHFHSKKNPIPQRIVHGTTIEILRTIFPSIIPMFIAIPSFALLYSMDEVVVDPAMTIKAIGHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRIIVTSADVPHSWAVPSSGVKCDAVPGRLNQISISVQREGVYYGQCSEICGTNHAFTPIVVEAVSRKDYGSRVSNQLIPQTGEA

COX2

Cytochrome c oxidase subunit 2

260 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.52 kDa

MIVREWLFFTMAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSWILVRALWHFHYKKNPIPQRIVHGTTIEIIRTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYRSYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHIRIIVTSADVLHSWAVPSSGVKCDAVPGRLNQTSILVQREGVYYGQCSEICGTNHAFMPIVVEAVSRKDYGSRVSNQLIPQTGEA

COX2

Cytochrome c oxidase subunit 2

260 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.437 kDa

MKFEWLFLTIAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSRILVRALWHFHYKKNPIPQRIVHGTTIEILRTIFPSIIPMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDLELGQSRLLEVDNRVVVPAKTHLRIIVTPADVPHSWAVPSLGVKCDAVPGRLNQISISVQREGVYYGQCSEICGTNHAFTPIVVEAVPSKDYGSRVFNQLIPQTTGEA

COX2

Cytochrome c oxidase subunit 2

260 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.437 kDa

MKFEWLFLTIAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSRILVRALWHFHYKKNPIPQRIVHGTTIEILRTIFPSIIPMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDLELGQSRLLEVDNRVVVPAKTHLRIIVTPADVPHSWAVPSLGVKCDAVPGRLNQISISVQREGVYYGQCSEICGTNHAFTPIVVEAVPSKDYGSRVFNQLIPQTTGEA

COX2

Cytochrome c oxidase subunit 2

260 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.68 kDa

MILRLLECRFFTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVLWMLVRALWHFNEQTNPIPQRIVHGTTIEIIWTIFPSVILLFIAIPSFALLYSMDGVLVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEVDNRVVVPAKTHLRMIVTSADVLHSWAVPSLGVKCDAVPGRLNLTSILVQREGVYYGQCSEICGTNHAFMPIVVEAVTLKDYADWVSNQLILQTN

COX2

Cytochrome c oxidase subunit 2

260 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.243 kDa

MILRSLECRFLTIALCDAAEPWQLGSQDAATPMMQGIIDLHHDIFFFLILILVFVSRMLVRALWHFNEQTNPIPQRIVHGTTIEIIRTIFPSVIPLFIAIPSFALLYSMDGVLVDPAITIKAIGHQWYRSYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRMIVTPADVLHSWAVPSSGVKCDAVPGRSNLTSISVQREGVYYGQCSEICGTNHAFTPIVVEAVTLKDYADWVSNQLILQTN

COX2

Cytochrome c oxidase subunit 2

260 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.515 kDa

MILRSLSCRFLTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVLWMLVRALWHFNEQTNPIPQRIVHGTTIEIIWTIFPSVILLFIAIPSFALLYSMDGVLVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRMIVTPADVLHSWAVPSLGVKCDAVPGRLNLTSILVQREGVYYGQCSEICGTNHAFMPIVVEAVTLKDYADWVSNQLILQTN

COX2

Cytochrome c oxidase subunit 2

260 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

29.674 kDa

MIVLKWLFFTISPCDAAEPWQLGFQDAATPIMQGIIDLHHDIFFFLILILVFVLWILVRALWHFHYKKNAIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEEDLELGQLRLLEVDNRVVVPAKTHLRIIVTSADVLHSWAVPSLGVKCDAVPGRLNQISILVQREGVYYGQCSEICGTNHAFMSIVVEAVSRKDYGSWVSNQLIPQTGEA

COX2

Cytochrome c oxidase subunit 2

258 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.457 kDa

MIVNECLFFTIALCDAAEPWQLGFQDAATPMMQGIIDLHHDILFFLILILVFVLWILVRALWHFYYKKNPIPQRIVHGTTIEILWTIFPSIILMFIAIPSFALLYSMDEVVVDPAMTLKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEVDNRVVVPVKTNLRLIVTSADVLHSWAVPSLGVKCDAVPGRLNQISMLVQREGVYYGQCSEICGTNHAFMPIVIEAVSATDYTNWVSNLFIPPTS

COX2

Cytochrome c oxidase subunit 2

258 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.001 kDa

MKLEWLFLTIAPCDAAEPWQLGFQDAATPMMQGIIDLHHDIFFFLILILVFVSRILVRALWHFHYKKNPIPQRIVHGTTIEILRTIFPSIIPMFIAIPSFALLYSMDGVLVDPAMTIKAIGHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDLELGQSGLLEVDNRVVVPAKTHLRIIVTPADVPHSWAVPSLGVKCDAVPGRLNQISISVQREGVYYGQCSEICGTNHAFPIVVEAVPSKDYGSRVSNQLIPQTGEA

COX2

Cytochrome c oxidase subunit 2

255 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.613 kDa

MFNLFPPFGANTAIFNDAPQPWQVGFQDGASPTQEGITELHDSIFFYLVIICFGVLWVLSSVIVNFNSNKSQLVYKYANHGTLIELIWTITPALVLIAIAFPSFKLLYLMDEVISPSMTVKVAGHQWYWSAEYSDFINEDGESIEFDSYMVPETDLEDGQLRLLEVDNRMVVPIDTHIRFIVTGADVIHDFAVPSLGLKIDAVPGRLNQTSVLIEREGVFYGQCSEICGVYHGFMPIAIEAVTPEKYLAWIDSQA

COX2

Cytochrome c oxidase subunit 2

255 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.512 kDa

MKFFFFSFINYKVLNDAARPWQIGFQDPATPIMEGIVNLHHDIIFFLIIIIIFVSWILFRTLFLFNSKTNPVAYNFSHGTFIELLWTLTPSLVLIGIAVPSFALLYSIDEIIDPAITIKAVGRQWYWSYEYSDYVNEENEFLAFHSYILPEEDLELGQFRLLEVDNRIIIPVNTHIRIIVTGADVIHSWAVPSLGVKCDAIPGRLNQISFFIKREGIYYGQCSEICGVNHGFMPIVIEAVSFDDYIRWVQNKILD

COX2

Cytochrome c oxidase subunit 2

254 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

29.186 kDa

MNNILNFYPAVITTDVAENWQIGFQDPATPIMEGIINLHYDLMFFICVISVFVSWMLGRTLWHFEQNQNKIPSSLTHGTLIEMIWTVTPAFILLIIAVPSFSLLYAMDEIISPAITIKTLGHQWYWSYEYSDYLNEDDDSINYDSYMIPEEDLEIGQFRLLEVDNRMVIPINTHIRVIVTAADVLHSWAVPSFRSKCDAIPGRLNQTSLFIKREGVYYGQCSEICGINHGFMPIVVEATSLPNYVSWISNKLNE

cox2

Cytochrome c oxidase subunit 2

252 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.931 kDa

MFLIMLKGHILMDAPTPWGIFFQDSASPQMEGIMELHNNIMFYLAIILFTVTWMMITIIRNFVAKKSPIAHKYMNHGTLIELIWTITPAFILILIAFPSFKLLYLMDEVMDPSLVVYAEGHQWYWSYQYPDFTNEDNEFIEFDSYIVPESDLEEGQFRMLEVDNRVIIPELTHTAFVISADVIHSYACPSLGIKADAYPGRLNQASVYINGPGTFFGQCSEICGILHSSMNIAIQSVSIKDFLLWLRDQMEG

cox2

Cytochrome c oxidase subunit 2

252 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.931 kDa

MFLIMLKGHILMDAPTPWGIFFQDSASPQMEGIMELHNNIMFYLAIILFTVTWMMITIIRNFVAKKSPIAHKYMNHGTLIELIWTITPAFILILIAFPSFKLLYLMDEVMDPSLVVYAEGHQWYWSYQYPDFTNEDNEFIEFDSYIVPESDLEEGQFRMLEVDNRVIIPELTHTAFVISADVIHSYACPSLGIKADAYPGRLNQASVYINGPGTFFGQCSEICGILHSSMNIAIQSVSIKDFLLWLRDQMEG

COX2

Cytochrome c oxidase subunit 2

251 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.602 kDa

MLNLLNTLFLNVISNDVPTPYGIYFQDSATPNQEGILELHDNIMFYLFIILGLVSWMLFTIVKTYSKNPMAYKYIKHGQTIEIIWTMFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDNGETIEFESYVIPDDLLEEGQLRLLDTDTSVVVPVDTHIRFVVTGADVIHDFAIPSLGIKVDANPGRLNQVSALIQREGVFYGQCSELCGVNHAAMPIKIEAVSLPKFLEWLNEQ

COX2

Cytochrome c oxidase subunit 2

251 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.567 kDa

MLDLLRLQLTTFIMNDVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ

COX2

Cytochrome c oxidase subunit 2

251 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.894 kDa

MNLIWIFPIAFCDAAEPWQLGFQDPATPMMQGIIDLHNDIFFFLIVILIFVLWMLVRALWHFHYKRNPIPERIVHGTTIEIIWTIFPSIILMFIAIPSFALLYSMDEVVDPAITIKAIGHQWYWTYEYSDYNSSDEQSLTFDSYMIPEDDLELGQLRLLEVDNRVVVPAKTHLRMIITSADVLHSWAVPSLGVKCDAVPGRLNQTSIFIKREGVYYGQCSELCGTNHGFMPIVVEAVSLDDYVSWVSNKLD

COX2

Cytochrome c oxidase subunit 2

249 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

28.249 kDa

MYILTNILSIISNDVPTPYALGFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTITKTYSKNPLPYKYMKHGQFIEIIWTIFPAVVLLIIAFPSFILLYLCDEVISPAMTVKVIGYQWYWKYEYSDFVNSNGETVEFESYIIPDDLLEEGQLRLLDTDTSVVVPVDTHIRFIVTAADVIHDFAIPSLGIKVDANPGRLNQVSALIQREGVFYGMCSELCGTGHSQMPIKIEVVSLGKYLGWLNEQ

COX2

Cytochrome c oxidase subunit 2

249 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.584 kDa

MLNLFQIMNMINNDVPTPYGFYFQDSATPNQEGILELHDNIMFYLVVILGLVSWMLFTIVRTYSRNPMAYKYIKHGQTIEIIWKIFPAVILLTIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYFDFINDNGETIEFESYVIPDSLLEEGQLRLLDTDTSIVVPVDTHIRFIVTAADVIHDFAIPSLGIKVDGTPGRLNQVSTLIQREGVFYGMCSELCGIGHAQMPIKVEAVSLPKFLEWLNEQ

COX2

Cytochrome c oxidase subunit 2

248 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.676 kDa

MLLMNLFTIINNDVPTPYNMYFQDSTTPHQEGILELHDNIMFYMLTVLGLVSWMMIIIIKDYKNNPITYKYIKHGQMIEIIWTILPAIILLMIAFPSFILLYLCDEVISPAMTIKVIGLQWYWKYEYSDFINDNGETIEYESYMIPEELLEEGQLRMLDTDTSIVIPVDTHVRFIVTATDVIHDFAVPSLGIKIDTTPGRLSQVSTLIQREGIFYGQCSELCGAQHSAMPIKIETVKLPTFLTWLNEQ

cox2

Cytochrome c oxidase subunit 2

248 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.121 kDa

MLFFNSILNDAPSSWALYFQDGASPSYLGVTHLNDYLMFYLTFIFIGVIYAICKAVIEYNYNSHPIAAKYTTHGSIVEFIWTLIPALILILVALPSFKLLYLLDEVQKPSMTVKAIGRQWFWTYELNDFVTNENEPVSFDSYMVPEEDLEEGSLRQLEVDNRLVLPIDTRIRLILTSGDVIHSWAVPSLGIKCDCIPGRLNQVSLSIDREGLFYGQCSELCGVLHSSMPIVVQGVSLEDFLAWLEENS

cox2

Cytochrome c oxidase subunit 2

248 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.121 kDa

MLFFNSILNDAPSSWALYFQDGASPSYLGVTHLNDYLMFYLTFIFIGVIYAICKAVIEYNYNSHPIAAKYTTHGSIVEFIWTLIPALILILVALPSFKLLYLLDEVQKPSMTVKAIGRQWFWTYELNDFVTNENEPVSFDSYMVPEEDLEEGSLRQLEVDNRLVLPIDTRIRLILTSGDVIHSWAVPSLGIKCDCIPGRLNQVSLSIDREGLFYGQCSELCGVLHSSMPIVVQGVSLEDFLAWLEENS

COX2

Cytochrome c oxidase subunit 2

248 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.554 kDa

MMKELLMNNMLNDVPTPWAMYFQDSATPNMEGIMELHNNVVFYLIIMLCFVTYMLYNISTVYNKSAVAYKYMNHGQFIEMVWTTFPAVMLLIMAFPSFMLLYICDEVMAPAMTIKAMGLQWYWKYEYSDFMDEKGETIEFESYIIPEDLLEDGQLRMLDVDASVVCPVDTHIRFIVTSADVIHDFCMPSLGIKIDAAPGRLNQTSALIQREGVYYGQCSELCGVMHSAMPIKIEVVPTADFLTWIDEQ

COX2

Cytochrome c oxidase subunit 2

247 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.69 kDa

MREMMMNNMLNDVPTPWAMYFQDSATPNMEGMMELHNNVLFYLCVMLGFVTYMLYNVMTVYNKSAMAYKYMNHGQFMEMMWTTFPAMMLLMMAFPSFMLLYMCDEVMAPAMTIKAMGLQWYWKYEYSDFMVEKGETMEFESYMIPEDLLEDGQLRMLDVDASVVCPVDTHMRFMVTSADVIHDFCMPSLGIKIDAAPGRLNQTSALMQREGVYYGQCSELCGVMHSSMPIKIEAVPTVDFLAWIDEQ

COX2

Cytochrome c oxidase subunit 2

247 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.69 kDa

MREMMMNNMLNDVPTPWAMYFQDSATPNMEGMMELHNNVLFYLCVMLGFVTYMLYNVMTVYNKSAMAYKYMNHGQFMEMMWTTFPAMMLLMMAFPSFMLLYMCDEVMAPAMTIKAMGLQWYWKYEYSDFMVEKGETMEFESYMIPEDLLEDGQLRMLDVDASVVCPVDTHMRFMVTSADVIHDFCMPSLGIKIDAAPGRLNQTSALMQREGVYYGQCSELCGVMHSSMPIKIEAVPTVDFLAWIDEQ

COX2

Cytochrome c oxidase subunit 2

247 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.571 kDa

MKEMMMSNMFNDVPTPWAMFFQDSATPNMEGMLELHNNVVFYLCMMLGFVTFMLYNMLTTYNKSVMPYKYLNQGQFMEMMWTTLPAVMLLMIAFPSFILLYMCDEVMAPAMTIKAMGLQWYWKYEYSDFMDEKGDTMEFESYMIPEDLLDEGQLRQLDVDAPIVCPVDTHIRFMVTAADVMHDFSVPSLGLKIDAVPGRLNQMSALMQREGVYYGQCSELCGVMHSSMPMKVEAVPTADFLAWIDEQ

COX2

Cytochrome c oxidase subunit 2

247 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

27.809 kDa

MLLIINNIINNDVPTPWGVYFQDSATPNHEGIIELHDNIMFYLVLILCLVSWLLFSIVKDGSKNPLPHKYLVHGQTIEIIWTILPALVLLVIAFPSFILLYLCDEVISPAMTIKAIGLQWYWKYEYSDFINDSGETIEFESYVIPEDLLEDGQLPLLDTDTSIVCPVNTHIRFIVSAADVIHDFAVPSLGIKIDACPGRLNQVSALIQREGVYYGQCSELCGVAHSAMPIKVEAVSLKEFLTWLNEQ

COX2

Cytochrome c oxidase subunit 2

247 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

27.941 kDa

MLLLINNLILNDVPTPWGLYFQDSSTPNQEGIIELHDNIMFYLVLILCTVSWLLFSIVKDSSKNPLPHKYLVHGQTIEIIWTILPAVVLLIIAFPSFILLYLCDEVISPAMTIKAIGLQWYWRYEYSDFINDSGETIEFESYVIPEDLLEDGQLRLLDTDTSVVCPVNTHIRFIVSAADVIHDFAIPSLGIKVDACPGRLNQVSALIQREGVYYGMCSETCGVAHSAMPIKIEVVSTKEFLTWLNEQ

COX2

Cytochrome c oxidase subunit 2

247 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

27.927 kDa

MLLLINNLILNDVPTPWGLYFQDSSTPNQEGIIELHDNIMFYLVLILCTVSWLLFSIVKDSSKNPLPHKYLVHGQTIEIIWTILPAVVLLIIAFPSFILLYLCDEVISPAMTIKAIGLQWYWRYEYSDFINDSGETIEFESYVIPEDLLEDGQLRLLDTDTSVVCPVNTHIRFIVSAADVIHDFAIPSLGIKVVASPGRLNQVSALIQREGVYYGMCSETCGVAHSAMPMKIEVVSTKEFLTWLNEQ

COX2

Cytochrome c oxidase subunit 2

246 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

28.359 kDa

MIWTDVPTPWGMRFQDAATPNAEGMHELYDHMMYYLALMLGLVSYMLYVMMKDYKNNTFAYKYIKHGQTLEIMWTMFPAVMLLLMAFPSFMLLYLCDEVLTPAMTVKVVGLQWYWKYEYSDFVSETGETVEYESYVMPEDMLEEGQLRLLDTDTSMVVPVDTHVRFMVTANDVLHCFTMPSLGIKVDACPGRLNQVSALMQRTGVYYGQCSELCGVNHGLMPIKTECVPIGDFVEWLGEQENVYVA

COX2

Cytochrome c oxidase subunit 2

245 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.275 kDa

MYMLNNMLNDVPTPWGMFFQDSATPNMEGMMELHNNVMFYLCMMLGFVSYMLYNMLTTYNHSVLPYKYLYHGQFIEIVWTTFPAMILLIIAFPSFILLYICDEVIAPAMTIKAMGLQWYWKYEYSDFIDDKGETIEFESYMIPEDLLEEGQLRQLDVDSPIVCPVDTHMRFIVTAADVIHDFAMPSLGIKIDAVPGRLNQTSALIQREGVYYGQCSELCGVMHSSMPIKIEAVSLGEFLAWIDEQ

COX2

Cytochrome c oxidase subunit 2

243 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

28.189 kDa

MMLNNMLNDVPTPWGMFFQDSATPNMEGMMELHNNVMFYLCMMLGFVSYMLYNMLHNNKSVLPYKYLYHGQFMEMVWTTIPAMMLLMMAFPSFILLYMCDEVMAPAMTIKAMGLQWYWKYEYSDFMDDKGETMEFESYMIPEDLLEEGQLRQLDVDSPMVCPVDTHMRFMVTAADVMHDFAMPSLGIKIDAVPGRLNQTSALIQREGVYYGQCSELCGVMHSSMPMKIEAVSLGEFLAWIDEQ

COX2

Cytochrome c oxidase subunit 2

242 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

27.636 kDa

MFKIFNDVPVPYGLYFQDSATPTFDGIIELHDIVMFYIVVTIVLVSYLLFVIIKNFSNDHISYKYLTHGTTLEIVWTIFPVVILLFIAFPSFILLYLCDEVIDPAMTIKAIASQWYWTYEYSDFIGETGEIVQFDSYIVPTDMLENGQLRMLDVDARIVVPTNTHLRFIVTSRDVIHDFALPSLGIKCDATPGRLNQVSALLQRESVYYGQCSELCGVLHSSMPIALEAVSIDKFLSWLDEQ

COX2

Cytochrome c oxidase subunit 2

237 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

27.154 kDa

MNLVAPTPWGLFFQDSATPQMEGIEELHNNIMFYLTIILFSVTWMMITIIKSFVNTKSPISHKYMNHGTLIELIWTITPAVILILIAFPSFKLLYLMDEVMDPSLVIYGEGHQWYWSYQYPDFTNADGEFVEFDSYIVPESDLEEGTLRMLEVDNRVIIPELTHTRFVISAADVIHSFACPSLGIKCDAYPGRLNQSSVYLNRQGTYFGQCSEICGILHSSMPIVIQSVSLKNFYYD

COX2

Cytochrome c oxidase subunit 2

26 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

2.875 kDa

single

DAAEPWQLGFQDAATPIMQGIIDLHH

COX2

Cytochrome c oxidase subunit 2

26 amino acids

Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1.

Belongs to the cytochrome c oxidase subunit 2 family.

2.875 kDa

single

DAAEPWQLGFQDAATPIMQGIIDLHH