Protein
Protein COLD-REGULATED 15B, chloroplastic
Organism
Arabidopsis thaliana
Function
Exhibits cryoprotective activity toward stromal substrates in chloroplasts and in protoplasts and confers freezing tolerance to plants in a CBF-dependent manner. Protectant against various stresses (e.g. cold, drought and heat stress) by preventing protein aggregation and attenuating enzyme inactivation. Influences the intrinsic curvature of the inner membrane of the chloroplast envelope, and modulates the freeze-induced lamellar-to-hexagonal II phase transitions that occur in regions where the plasma membrane is brought into close apposition with the chloroplast envelope during freeze-induced osmotic contraction (By similarity). Mediates a shift in the melting curves of phospholipids-containing membranes to lower temperatures (PubMed:20510170). Involved in the regulation of leaf senescence by abscisic acid (ABA) in a VNI2-dependent manner (PubMed:21673078).
Similarity
Belongs to the COR15 protein family.
Sequence
MAMSLSGAVLSGMGSSFHNVGAKQSGVGTVRVGRKSELVVVAQRKKSLIYAVKSDGNILDDLNEATKKASDFVTDKTKEALADGEKTKDYIVEKTIEANETATEEAKKALDYVTEKGKEAGNKAAEFVEGKAEEAKNATKS