COMMD9

COMM domain-containing protein 9

198 amino acids

May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. May down-regulate activation of NF-kappa-B. Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits.

21.781 kDa

MAALTAENFAALQSLLKASSKDVVRQLCQESFSSSALGSKNLLDVTCSSLSVTQEEAEQLLQALHRLTRLAVFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSAWRAEAQVNQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDRPSVSDVTVELSKETLDTMLDGLGRIRDQLSAVASK

COMMD9

COMM domain-containing protein 9

198 amino acids

May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF-kappa-B (PubMed:15799966). Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits (PubMed:23637203).

21.819 kDa

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

Commd9

COMM domain-containing protein 9

198 amino acids

May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. May down-regulate activation of NF-kappa-B. Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits.

21.85 kDa

MAALTAEHFVALQSLLKASSKDVVRQLCQESFSSSCLDSESLLDKTCSSLSVPQGEAAQLLQALHHFTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIIVEHISTWRAEAQANQISLPRLVDLDWRVDIKTSSDNISRMAVPTCLLQMKIQEDPSLCGEKPSISAVTMELSKETLDTMLDGLGRIRDQLSAVANK