CLPP4

ATP-dependent Clp protease proteolytic subunit 4, chloroplastic

292 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity). Essential protein required for chloroplast development and integrity (PubMed:16705403, PubMed:17241447). Essential for Embryogenesis (PubMed:23548781).

Belongs to the peptidase S14 family.

31.498 kDa

MGTLSLSSSLKPSLVSSRLNSSSSASSSSFPKPNNLYLKPTKLISPPLRTTSPSPLRFANASIEMSQTQESAIRGAESDVMGLLLRERIVFLGSSIDDFVADAIMSQLLLLDAKDPKKDIKLFINSPGGSLSATMAIYDVVQLVRADVSTIALGIAASTASIILGAGTKGKRFAMPNTRIMIHQPLGGASGQAIDVEIQAKEVMHNKNNVTSIIAGCTSRSFEQVLKDIDRDRYMSPIEAVEYGLIDGVIDGDSIIPLEPVPDRVKPRVNYEEISKDPMKFLTPEIPDDEIY

clpP4

ATP-dependent Clp protease proteolytic subunit 4

238 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.987 kDa

MIESFSRLTQAGPGSPRRATVQAAASGLGSADDQVFSRLLENRIVFLGSVVEDAVANAISAKLLLLAAEDPAADIYLYINSPGGSVSAGMAIYDTMQYVGNDVATVALGLAGSMGQFLLCAGTAGKRYALPHARIMMHQPHGGIGGTAADISIQAEQMLYTKRTLQERIAFHTGQTVEQIETDSDRDRWFTAEEAKEYGLVDHVVVRADQVPSVVSGAGMGLRRAGRTGFGPGGGSGR

clpP4

ATP-dependent Clp protease proteolytic subunit 4

226 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.919 kDa

MNDYPGSGLHARTQAEYTGARAESRYVIPRFVERTSQGVREYDPYAKLFEERVIFLGVQIDDASANDVMAQLLCLESMDPDRDISVYINSPGGSFTALTAIYDTMQFVKPDIQTVCMGQAASAAAILLAAGTPGKRMALPNARVLIHQPYSETGRGQVSDLEIAANEILRMRSQLEDMLAKHSTTPIEKIREDIERDKILTAEDALAYGLIDQIISTRKMNNSAVA

clpP4

ATP-dependent Clp protease proteolytic subunit 4

219 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

24.032 kDa

MENYFVNSEKKHLIQSSISSYESIHKTIGAVPTVIEQSGRGERAFDIYSRLLRERIIFLGSGINDQVSDSLVAQLLFLEAEDPEKDIQIYINSPGGSVTAGMAIYDTMQQISPDVVTICFGVAASMGAFLLSGGAKGKRLALPNSRIMIHQPLGGAQGQAVEIEIQAKEILFLKKTLNSLLAEHTGQPLEKINEDTERDYFLSPSEAVEYGLIDKVIKK

clpP4

Putative ATP-dependent Clp protease proteolytic subunit-like

200 amino acids

Has lost one of the conserved residue (His) proposed to be part of the active site. Therefore it could be inactive.

Belongs to the peptidase S14 family.

21.659 kDa

MGSYTIPNVVERTPQGERSYDVFSRLLSERIIFLGTEIDDGVANVVIAQLLHLESSAPESEIAVYINSPGGSFTSLMAIYDTMTFVQAPISTFCVGQAASTAAVLLAGGDPGRRFVLEHARVLLGQPASGGRQGTVSDLALQAKEMVRIRSQVEEVLARHTHHDVATLRADMDRDKVFTAQEAVAYGLADEVLARRLTRV

clpP4

ATP-dependent Clp protease proteolytic subunit 4

194 amino acids

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.

Belongs to the peptidase S14 family.

21.139 kDa

MSQYTIPHVIERTPAGERSFDIFSRLLNERIVFLGTEIDDGVANVVMAQLLHLQADSSDQEIGLYINSPGGSTTAMLAIYDTMQFLRPTIATYCMGQAASAAAVLLAAGTKGHRHVLAHSRTLLHQPSTQGNGTISDLALQAAEIMRVRSQTEAILSKHTGQTVERLRRDTDRDRIFTAEEAIEYGLADTLVAA