CLEC7A

C-type lectin domain family 7 member A

247 amino acids

Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation (By similarity).

27.76 kDa

MEYQSSVENLDEDGYTQLDFSSRNITRRSVVSEKGLCAASSHWRLIAVTLGILCSVMLVITVVLSTSGIWRSSSGNNLLKSDSFPSRNKDNQSQPTQSSLEDSVIPTKALTTTGVFSSSCPPNWITHEDSCYLFSTLLDSWDGSKRQCFQLGSHLLKIDSSKELEFISRQVSSQPDHSFWIGLSRRQTEEPWLWEDGSTLLSNLFQIRSTVTEKDSSHNCAWIHVSDIYDQLCSVHSYSICEKKLSV

CLEC7A

C-type lectin domain family 7 member A

247 amino acids

Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation (By similarity).

27.627 kDa

MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM

CLEC7A

C-type lectin domain family 7 member A

247 amino acids

Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation (By similarity).

27.648 kDa

MEYHPDLENLDEDGYTQLHFDSRSNTRIAVVSEKGSCVASPPWRLIAVILGILCLVILVIAVVLGTMAIWRPNSGRNSLENGYFPSRNKENHSQPTQSPLEESVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSPSLNSWDQSKRQCSQLGSNLIKIDSSKELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSCSICEKKFSM

Clec7a

C-type lectin domain family 7 member A

244 amino acids

Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation.

27.42 kDa

MKYHSHIENLDEDGYTQLDFSTQDIHKRPRGSEKGSQAPSSPWRPIAVGLGILCFVVVVVAAVLGALGEYGHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL