Function
Possesses protease activity in vitro (PubMed:25035401). Involved in the final stage of developmental programmed cell death and in intercalation of new cells. Cleaves extensins, thus probably supporting the final cell collapse (PubMed:21632425). During the compatible interaction with the biotrophic powdery mildew fungus Erysiphe cruciferarum, involved in the control of late epidermal cell death that limits growth and susceptibility to the parasite (PubMed:24605116). During anther development, involved in tapetal programmed cell death (PCD), leading to degeneration of tapetal cells and functional pollen formation (PubMed:25035401).
Sequence
MKRFIVLALCMLMVLETTKGLDFHNKDVESENSLWELYERWRSHHTVARSLEEKAKRFNVFKHNVKHIHETNKKDKSYKLKLNKFGDMTSEEFRRTYAGSNIKHHRMFQGEKKATKSFMYANVNTLPTSVDWRKNGAVTPVKNQGQCGSCWAFSTVVAVEGINQIRTKKLTSLSEQELVDCDTNQNQGCNGGLMDLAFEFIKEKGGLTSELVYPYKASDETCDTNKENAPVVSIDGHEDVPKNSEDDLMKAVANQPVSVAIDAGGSDFQFYSEGVFTGRCGTELNHGVAVVGYGTTIDGTKYWIVKNSWGEEWGEKGYIRMQRGIRHKEGLCGIAMEASYPLKNSNTNPSRLSLDSLKDEL