CDSP32

Thioredoxin-like protein CDSP32, chloroplastic

302 amino acids

Probable thiol-disulfide oxidoreductase involved in resistance to oxidative stress. May participate in the reduction of alkyl hydroperoxides derived from oxidative stress by acting as a physiological electron donor to the BAS1 peroxiredoxin. May regenerate methionine sulfoxide reductase B1 (MSRB1) activity through sulfenic acid reduction.

Belongs to the thioredoxin family.

33.685 kDa

MATVANFLAKPISTVVPRPSSAVASTSSFVFFNHKTNPLFRRKNLPKRLFSAVKIKAGAASPGKVGTPPANDEKVQKIHSGEEFDVALKNAKSKLVVAEFATSKSDQSNKIYPFMVELSRTCNDVVFLLVMGDESDKTRELCRREKIEKVPHFSFYKSMEKIHEEEGIEPDQLMGDVLYYGDNHSAVVQLHGRPDVEKLIDENRTGGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETVVFARMNGDENDSCMEFLKDMNVIEVPTFLFIRDGEIRGRYVGSGKGELIGEILRYSGVRVTY

CDSP32

Thioredoxin-like protein CDSP32, chloroplastic

301 amino acids

Thiol-disulfide oxidoreductase that may participate in various redox reactions. May act as electron donor to the BAS1 peroxiredoxin. Possesses low insulin disulfide bonds reducing activity.

Belongs to the thioredoxin family.

32.155 kDa

MASTAAFLSTLAGSTSLGGATPASGGGSGRSKTARFLRRRRRGGAVRAAVSGTEQAPETTKKKGGGGGGGDERVVQVHSAEELDGALRAAKERLVVVEFAASHSVNSSRIYPCMVELSRTCGDVDFLLVMGDESDATRELCRREGITAVPHFTFYKGAEKVHEEEGIGPDQLAGDVLYYGDHHSAVVQLHSRADVESLISDHRGEGGKLVVLDVGLKRCGPCVKVYPTVVKLSRTMADTTVFARMNGDENDSCMEFLRDMDVVEVPTFLFIRDGDIVGRYVGSGRGELIGEILRYNGVKVT