CDK5RAP3

CDK5 regulatory subunit-associated protein 3

506 amino acids

(Microbial infection) May be negatively regulated by hepatitis B virus large envelope protein mutant pre-s2 to promote mitotic entry.

Belongs to the CDK5RAP3 family.

56.921 kDa

MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL

CDK5RAP3

CDK5 regulatory subunit-associated protein 3

506 amino acids

Probable tumor suppressor initially identified as a CDK5R1 interactor controlling cell proliferation. Negatively regulates NF-kappa-B-mediated gene transcription through the control of RELA phosphorylation. Also regulates mitotic G2/M transition checkpoint and mitotic G2 DNA damage checkpoint. Through its interaction with CDKN2A/ARF and MDM2 may induce MDM2-dependent p53/TP53 ubiquitination, stabilization and activation in the nucleus, thereby promoting G1 cell cycle arrest and inhibition of cell proliferation. May play a role in the unfolded protein response, mediating the ufmylation of multiple proteins in response to endoplasmic reticulum stress. May also play a role in the rupture of the nuclear envelope during apoptosis. May regulate MAPK14 activity by regulating its dephosphorylation by PPM1D/WIP1.

Belongs to the CDK5RAP3 family.

56.946 kDa

MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAETGAAARQSLGEAIDVYQASVGFVCESHTEQVLPMLQFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAKAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLARRAVELSEEADVLSVSQFQLAPAILQGQTKEKTVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL

Cdk5rap3

CDK5 regulatory subunit-associated protein 3

504 amino acids

Probable tumor suppressor initially identified as a CDK5R1 interactor controlling cell proliferation. Negatively regulates NF-kappa-B-mediated gene transcription through the control of RELA phosphorylation. Also regulates mitotic G2/M transition checkpoint and mitotic G2 DNA damage checkpoint. Through its interaction with CDKN2A/ARF and MDM2 may induce MDM2-dependent p53/TP53 ubiquitination, stabilization and activation in the nucleus, thereby promoting G1 cell cycle arrest and inhibition of cell proliferation. May play a role in the unfolded protein response, mediating the ufmylation of multiple proteins in response to endoplasmic reticulum stress. May also play a role in the rupture of the nuclear envelope during apoptosis. May regulate MAPK14 activity by regulating its dephosphorylation by PPM1D/WIP1.

Belongs to the CDK5RAP3 family.

57.045 kDa

MQDHQHVPIDIQTSKLLDWLVDRRHCNLKWQSLVLTIREKINTAIQDMPESQEIAQLLSGSYIHYFHCLRIVDLLKGTEASTKNIFGRYSSQRMKDWQEIISLYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQDYSRKEEEGQAGAAEMREQFYHSCKQYGITGDNVRRELLALVKDLPSQLAEIGAGAQSLGEAIDLYQACVEFVCDSPTEQVLPMLRYVQPKGNSTVYEWRTGTEPSVVERPQLEDPPEQVQEDEIDWGDFGLEAVSDSGNIISAETPGIDWGISLESESKDAGADKIDWGDNAVASEITVLETGTEAPEGVARGSDALTLLEYPETRNQFIDELMELEIFLSQRAVEMSEEADILSVSQFQLAPAILQGQTKEKMLSLVSTLQHLIGQLTSLDLQHLFMILASPRYVDRVTELLQQKLKQSQLLALKKDLMVEKQQEALQEQAALEPKLDLLLEKTRELQKLIEADISKRYNGRPVNLMGTSV

Cdk5rap3

CDK5 regulatory subunit-associated protein 3

503 amino acids

Probable tumor suppressor initially identified as a CDK5R1 interactor controlling cell proliferation. Negatively regulates NF-kappa-B-mediated gene transcription through the control of RELA phosphorylation. Also regulates mitotic G2/M transition checkpoint and mitotic G2 DNA damage checkpoint. Through its interaction with CDKN2A/ARF and MDM2 may induce MDM2-dependent p53/TP53 ubiquitination, stabilization and activation in the nucleus, thereby promoting G1 cell cycle arrest and inhibition of cell proliferation. May play a role in the unfolded protein response, mediating the ufmylation of multiple proteins in response to endoplasmic reticulum stress. May also play a role in the rupture of the nuclear envelope during apoptosis. May regulate MAPK14 activity by regulating its dephosphorylation by PPM1D/WIP1.

Belongs to the CDK5RAP3 family.

56.991 kDa

MQDHQHVPIDIQTSKLLDWLVDRRHCNLKWQSLVLTIREKINTAIQDMPESQEIAQLLSGSYIHYFHCLRIVDLLKGTEASTKNIFGRYSSQRMKDWQEIVSLYEKDNTYLVELCSLLVRNVSYEIPSLKKQIAKCQQLQQEYSRKEEEGQAGAAEMREQFYHSCKQYGITGDNVRRELLALVKDLPSQLAEIGAGAQSLGEAIDLYQACVEFVCDSPTEQVLPMLRYVQKKGNSTVYEWRTGTEPSVVERPQLEEPPEQVQEDEIDWGDFGVEAVSDSGIVAETPGIDWGISLESEAKDAGADKIDWGDDAAAASEITVLETGTEAPEGVARGSDALTLLEYPETRNQFIDELMELEIFLSQRAVEMSEEADILSVSQFQLAPAILQGQTKEKMLSLVSTLQQLIGRLTSLRMQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVEKQQEALQEQAALEPKLDLLLEKTRELQKLIEADISKRYSGRPVNLMGTSL