cdc42se2

CDC42 small effector protein 2

85 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly.

Belongs to the CDC42SE/SPEC family.

9.426 kDa

MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFTGMNSVNSIQNQMQSKGGYGGEAMSVNVQMQLVDTKAG

CDC42SE2

CDC42 small effector protein 2

84 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).

Belongs to the CDC42SE/SPEC family.

9.197 kDa

MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMAANVQMQLVDTKAG

CDC42SE2

CDC42 small effector protein 2

84 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.

Belongs to the CDC42SE/SPEC family.

9.223 kDa

MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG

Cdc42se2

CDC42 small effector protein 2

84 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).

Belongs to the CDC42SE/SPEC family.

9.223 kDa

MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG

CDC42SE2

CDC42 small effector protein 2

84 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).

Belongs to the CDC42SE/SPEC family.

9.168 kDa

MSEFWLCFSCCIAEQPQPKRRRRIDRSMIGEPTNFAHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG

Cdc42se2

CDC42 small effector protein 2

83 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).

Belongs to the CDC42SE/SPEC family.

9.095 kDa

MSEFWLCFNCCIAEQPQPRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG