Cdc42se1

CDC42 small effector protein 1

80 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).

Belongs to the CDC42SE/SPEC family.

9.076 kDa

MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNHRDRPWSNSRAL

CDC42SE1

CDC42 small effector protein 1

79 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).

Belongs to the CDC42SE/SPEC family.

8.925 kDa

MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL

CDC42SE1

CDC42 small effector protein 1

79 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.

Belongs to the CDC42SE/SPEC family.

8.925 kDa

MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL

CDC42SE1

CDC42 small effector protein 1

79 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).

Belongs to the CDC42SE/SPEC family.

8.953 kDa

MSEFWHKLGCCVVEKPQPKKRRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL

Cdc42se1

CDC42 small effector protein 1

79 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).

Belongs to the CDC42SE/SPEC family.

8.967 kDa

MSEFWHKLGCCVVEKPQPKKRRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRAL

cdc42se1

CDC42 small effector protein 1

79 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly.

Belongs to the CDC42SE/SPEC family.

8.855 kDa

MSDFWHKLGCCVVEKPQPKKKRKRIDRSMIGEPMNFVHLTHIGSGDMGASDGLPRAGGVQEQMRSKCGRDRQWSNSGVL

CDC42SE1

CDC42 small effector protein 1

78 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly.

Belongs to the CDC42SE/SPEC family.

8.84 kDa

MSDFWHKLGCCVVEKPQPKKRRRRIDRSMIGEPMNFVHLTHIGSGDMAAGEGLPMTGAVQEMRSKGGRERQWSSSRVL

cdc42se1

CDC42 small effector protein 1

75 amino acids

Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly.

Belongs to the CDC42SE/SPEC family.

8.35 kDa

MSAFWHKIGCCVVAKPPPKKKRRRIDRSMIGEPTNFVHLTHIGSGEMADGMQPSGPIKEQMRSKVPHANGRNSLL