CCL5

C-C motif chemokine 5

92 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.167 kDa

MKVSTAAFAVLLTAAAFCTPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMPAVVFVTRRKRQVCANPQKKWVRDKGINSLEMN

Ccl5

C-C motif chemokine 5

92 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.17 kDa

MKISAAASLTVILVAAALCTPVPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

CCL5

C-C motif chemokine 5

92 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.167 kDa

MKVSTAAFAVLLTAAAFCTPASASPYASDTTPCCFAYLSHPLPLTHLQEYFYTSSKCSMPAVVFVTRRKRQVCANPQKKWVRDKGINSLEMN

Ccl5

C-C motif chemokine 5

92 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.17 kDa

MKISAAASLTVILVAAALCTPVPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.059 kDa

MKVSATAFAVLLMAAALCAPASASPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.179 kDa

MKVSAATFAILLATATFRAPASASPYASDTTPCCFAYISGRLPFTHVQEYFYTSSKCSMPAVVFVTRKHRQVCANPQKKWVREYINSLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.088 kDa

MKVSAAALCVILTTAALCVPASASPYASDTTPCCFAYISRALPRTHIKEYFYTSSKCSNLAVVFVTRKNRQVCANPEKKWVREYINSLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.159 kDa

MKVFAAALAVILATATFCTPASASPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils (PubMed:16791620, PubMed:1380064, PubMed:8525373, PubMed:9516414, PubMed:15923218). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485).

Belongs to the intercrine beta (chemokine CC) family.

9.99 kDa

MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.019 kDa

MKVSAARLAVILVATALCAPASASPHASDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Ccl5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.071 kDa

MKISAAALTIILTAAALCTPAPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.082 kDa

MKISAAVLTVVLMAASLCAPASASPNGSDTIPCCFAYLSAVLPRAHVKEYFYTSSKCSNFAVVFVTRRNRQVCANPKKKWVQEYINYLELK

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.059 kDa

MKVSATAFAVLLMAAALCAPASASPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.179 kDa

MKVSAATFAILLATATFRAPASASPYASDTTPCCFAYISGRLPFTHVQEYFYTSSKCSMPAVVFVTRKHRQVCANPQKKWVREYINSLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.088 kDa

MKVSAAALCVILTTAALCVPASASPYASDTTPCCFAYISRALPRTHIKEYFYTSSKCSNLAVVFVTRKNRQVCANPEKKWVREYINSLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.159 kDa

MKVFAAALAVILATATFCTPASASPYASDTTPCCFAYISRPLPRAHIQEYFYTSSKCSIPAVVFVTRKKRQVCANPEKKWVREYINTLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils (PubMed:16791620, PubMed:1380064, PubMed:8525373, PubMed:9516414, PubMed:15923218). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485).

Belongs to the intercrine beta (chemokine CC) family.

9.99 kDa

MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.019 kDa

MKVSAARLAVILVATALCAPASASPHASDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Ccl5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.071 kDa

MKISAAALTIILTAAALCTPAPASPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS

CCL5

C-C motif chemokine 5

91 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

10.082 kDa

MKISAAVLTVVLMAASLCAPASASPNGSDTIPCCFAYLSAVLPRAHVKEYFYTSSKCSNFAVVFVTRRNRQVCANPKKKWVQEYINYLELK

CCL5

C-C motif chemokine 5

50 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

5.937 kDa

single

RCPXHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINSLELS

CCL5

C-C motif chemokine 5

50 amino acids

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. May also be an agonist of the G protein-coupled receptor GPR75. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells.

Belongs to the intercrine beta (chemokine CC) family.

5.937 kDa

single

RCPXHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINSLELS