CCL17

C-C motif chemokine 17

99 amino acids

Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8 (By similarity).

Belongs to the intercrine beta (chemokine CC) family.

11.052 kDa

MIPLKMLLLVTLLLGASLQVTHAARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES

CCL17

C-C motif chemokine 17

99 amino acids

Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8 (By similarity).

Belongs to the intercrine beta (chemokine CC) family.

11.056 kDa

MMSLKLLLLVMLLLGASLQVTHAARATNVGRECCLEYFKGAIPLRRLTGWYRTSGECSKDAIVFVTIHGKSICSDPKDTRVKKTVRYLQSIMNPVPQES

CCL17

C-C motif chemokine 17

94 amino acids

Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4.

Belongs to the intercrine beta (chemokine CC) family.

10.507 kDa

MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

CCL17

C-C motif chemokine 17

94 amino acids

Chemotactic factor for T-lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 (By similarity).

Belongs to the intercrine beta (chemokine CC) family.

10.549 kDa

MAPLKMLALVILLLGASLQHIHAARGTNVGRECCLKYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQNKAICSDPNDKKVKKALKYLQSLERS