CBL7

Calcineurin B-like protein 7

214 amino acids

Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.

Belongs to the calcineurin regulatory subunit family.

24.404 kDa

MDSTRNSASSNSTGCFTDQKKRKALYEVFKKLSGVDCQRNEGNVVEGVTCYYGEMNKEQFHVAIFQTDKNESLFSERVFDLFDTNHDGLLGFEEFARALSVFHPSAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVATLAASGMSQSDEIVESIIDKTFVQADTKHEGMIDEEEWMDLVFRHPLLLKNMTLQYLKDITTTFPSFVLHSQVEDT

CBL7

Calcineurin B-like protein 7

213 amino acids

Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner (By similarity).

Belongs to the calcineurin regulatory subunit family.

24.4 kDa

MGCISSKQFKRAAEHEDPAILAKETTFSVSEVEALYELFKKISHSIFKDGLIHKEEFQLALFRNSNKKNLFADRIFDLFDLKRNGVIDFGEFVRSLNIFHPETPLAEKIAFAFRLYDLRGTGYIEREELYEMVLAILNESDLLLSDDAVEQIVDQTFKQADLNSDGKIDPDEWKAFASKNPALLKNMTLPYLKDITMAFPSFVLNSGVDDEEL