CBL4

Calcineurin B-like protein 4

222 amino acids

Acts as a calcium sensor involved in the regulatory pathway for the control of intracellular Na(+) and K(+) homeostasis and salt tolerance. Binding of a CBL protein to the regulatory NAF domain of a CIPK serine-threonine protein kinase lead to the activation of the kinase in a calcium-dependent manner. Operates in synergy with CIPK24/SOS2 to activate the plasma membrane Na(+)/H(+) antiporter SOS1. Involved in salt stress responses by mediating calcium-dependent microfilament reorganization. The CBL4/CIPK6 complex mediates translocation of AKT2 from the endoplasmic reticulum to the plasma membrane. Both myristoylation and S-acylation are required for AKT2 activation.

Belongs to the calcineurin regulatory subunit family.

25.693 kDa

MGCSVSKKKKKNAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEEFQLALFRNRNRRNLFADRIFDVFDVKRNGVIEFGEFVRSLGVFHPSAPVHEKVKFAFKLYDLRQTGFIEREELKEMVVALLHESELVLSEDMIEVMVDKAFVQADRKNDGKIDIDEWKDFVSLNPSLIKNMTLPYLKDINRTFPSFVSSCEEEEMELQNVSS

CBL4

Calcineurin B-like protein 4

210 amino acids

Acts as a calcium sensor involved in the regulatory pathway for the control of intracellular Na(+) and K(+) homeostasis and salt tolerance. Operates in synergy with CIPK24 to activate the plasma membrane Na(+)/H(+) antiporter SOS1. May function as positive regulator of salt stress responses. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.

Belongs to the calcineurin regulatory subunit family.

23.916 kDa

MGCASSKQFKRPPGYEEPAVLAAQTTFTVNEVEALRELYNKMSYSIIKDGLIHKEEFQLALFRNSRKANLFADRVFDLFDLKRNGVIEFGEFVRSLSVFHPKAPKSEKTAFAFKLYDLRGTGYIEKEELREMVLALLDESDLHLSECAVEAIVDNTFSQADSNGDGRIDPEEWEEFVKANPASLRNMSLPYLQDITMAFPSFVMHSEAHD