Protein
Calcineurin B-like protein 1
Organism
Arabidopsis thaliana
Function
Acts as a calcium sensor involved in the signaling pathway during growth and development and in response to abiotic stresses. May function as a positive regulator of salt and drought responses and as a negative regulator of cold response. Contributes to the regulation of early stress-related CBF/DREB transcription factors. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner. Mediates the activation of AKT1 by CIPK proteins (CIPK6, CIPK16, and CIPK23) in response to low potassium conditions and in the context of stomatal movement. Involved in response to glucose and gibberellin during germination and seedling development and in response to cold stress. Involved in the calcium-dependent regulation by CIPK26 of reactive oxygen species production by the NADPH oxidase RBOHF.
Similarity
Belongs to the calcineurin regulatory subunit family.
Sequence
MGCFHSKAAKEFRGHEDPVKLASETAFSVSEVEALFELFKSISSSVVDDGLINKEEFQLALFKSRKRENIFANRIFDMFDVKRKGVIDFGDFVRSLNVFHPNASLEDKIDFTFRLYDMDCTGYIERQEVKQMLIALLCESEMKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIMTLPYLRDITTTFPSFVFHSEVDEIAT