CAVIN2

Caveolae-associated protein 2

425 amino acids

Plays an important role in caveolar biogenesis and morphology. Regulates caveolae morphology by inducing membrane curvature within caveolae (PubMed:19525939). Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in the lung and fat endothelia but not in the heart endothelia. Negatively regulates the size or stability of CAVIN complexes in the lung endothelial cells. May play a role in targeting PRKCA to caveolae (By similarity).

Belongs to the CAVIN family.

47.173 kDa

MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRKKVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGEIAEEAAEKATSRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQVHQTS

CAVIN2

Caveolae-associated protein 2

425 amino acids

Plays an important role in caveolar biogenesis and morphology. Regulates caveolae morphology by inducing membrane curvature within caveolae (PubMed:19525939). Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in the lung and fat endothelia but not in the heart endothelia. Negatively regulates the size or stability of CAVIN complexes in the lung endothelial cells. May play a role in targeting PRKCA to caveolae (By similarity).

Belongs to the CAVIN family.

47.173 kDa

MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTLLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAVEGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRKKVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGEIAEEAAEKATSRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQVHQTS

Cavin2

Caveolae-associated protein 2

418 amino acids

Plays an important role in caveolar biogenesis and morphology. Regulates caveolae morphology by inducing membrane curvature within caveolae (By similarity). Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in the lung and fat endothelia but not in the heart endothelia. Negatively regulates the size or stability of CAVIN complexes in the lung endothelial cells (PubMed:23652019). May play a role in targeting PRKCA to caveolae (By similarity).

Belongs to the CAVIN family.

46.764 kDa

MGEDAAQAEKFQHPNTDMLQEKPSSPSPMPSSTPSPSLNLGSTEEAIRDNSQVNAVTVHTLLDKLVNMLDAVRENQHNMEQRQINLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVRERLERQCVQVKRLENNHAQLLRRNHFKVLIFQEESEIPASVFVKEPVPSAAEGKEELADENKSLEETLHNVDLSSDDELPRDEEALEDSAEEKMEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTPNHQKASSGKSSPFKVSPLSFGRKKVREGESSVENETKLEDQMQEDREEGSFTEGLSEASLPSGLMEGSAEDAEKSARRGNNSAVGSNADLTIEEDEEEEPVALQQAQQVRYESGYMLNSEEMEEPSEKQVQPAVLHVDQTA

Cavin2

Caveolae-associated protein 2

418 amino acids

Plays an important role in caveolar biogenesis and morphology. Regulates caveolae morphology by inducing membrane curvature within caveolae (By similarity). Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in the lung and fat endothelia but not in the heart endothelia. Negatively regulates the size or stability of CAVIN complexes in the lung endothelial cells (PubMed:23652019). May play a role in targeting PRKCA to caveolae (By similarity).

Belongs to the CAVIN family.

46.764 kDa

MGEDAAQAEKFQHPNTDMLQEKPSSPSPMPSSTPSPSLNLGSTEEAIRDNSQVNAVTVHTLLDKLVNMLDAVRENQHNMEQRQINLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVRERLERQCVQVKRLENNHAQLLRRNHFKVLIFQEESEIPASVFVKEPVPSAAEGKEELADENKSLEETLHNVDLSSDDELPRDEEALEDSAEEKMEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTPNHQKASSGKSSPFKVSPLSFGRKKVREGESSVENETKLEDQMQEDREEGSFTEGLSEASLPSGLMEGSAEDAEKSARRGNNSAVGSNADLTIEEDEEEEPVALQQAQQVRYESGYMLNSEEMEEPSEKQVQPAVLHVDQTA

Cavin2

Caveolae-associated protein 2

417 amino acids

Plays an important role in caveolar biogenesis and morphology. Regulates caveolae morphology by inducing membrane curvature within caveolae. Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in the lung and fat endothelia but not in the heart endothelia. Negatively regulates the size or stability of CAVIN complexes in the lung endothelial cells (By similarity). May play a role in targeting PRKCA to caveolae (PubMed:9566962).

Belongs to the CAVIN family.

46.386 kDa

MGEDAAQAEKFQHPNTDMLQEKPSNPSPMPSSTPSPSLNLGSTEEAIRDNSQVNAVTVHTLLDKLVNMLDAVRENQHNMEQRQINLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVRERLEKQCVQVKRLENNHAQLLRRNHFKVLIFQEESEIPASVFVKEPVPSTAEGKELADENKSLEETLHNVDLSSDDELPGDEEALEDSAEEKMEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTPNHQKASSGKSSPFKVSPLSFGRKKIREGESSAENETKLEEQVQDDHEEGSFTEGLSEASLPSGLLEGSAEDAEKSALRGNNSGVGSNADLTIEEDEEEESVALQQAQQVRYESGYMLNSKEMEESSEKHVQAAVLHVDQTA

Cavin2

Caveolae-associated protein 2

417 amino acids

Plays an important role in caveolar biogenesis and morphology. Regulates caveolae morphology by inducing membrane curvature within caveolae. Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in the lung and fat endothelia but not in the heart endothelia. Negatively regulates the size or stability of CAVIN complexes in the lung endothelial cells (By similarity). May play a role in targeting PRKCA to caveolae (PubMed:9566962).

Belongs to the CAVIN family.

46.386 kDa

MGEDAAQAEKFQHPNTDMLQEKPSNPSPMPSSTPSPSLNLGSTEEAIRDNSQVNAVTVHTLLDKLVNMLDAVRENQHNMEQRQINLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVRERLEKQCVQVKRLENNHAQLLRRNHFKVLIFQEESEIPASVFVKEPVPSTAEGKELADENKSLEETLHNVDLSSDDELPGDEEALEDSAEEKMEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTPNHQKASSGKSSPFKVSPLSFGRKKIREGESSAENETKLEEQVQDDHEEGSFTEGLSEASLPSGLLEGSAEDAEKSALRGNNSGVGSNADLTIEEDEEEESVALQQAQQVRYESGYMLNSKEMEESSEKHVQAAVLHVDQTA