cal1

Calnexin homolog

560 amino acids

Calcium-binding protein that interacts with newly synthesized glycoproteins in the endoplasmic reticulum. It may act in assisting protein assembly and/or in the retention within the ER of unassembled protein subunits. It seems to play a major role in the quality control apparatus of the ER by the retention of incorrectly folded proteins.

Belongs to the calreticulin family.

63.466 kDa

MKYGKVSFLALLCSLYVRGSLADPESEQEPLVFNPTEVKAPLVEQFQGAWSERWIPSHAKRFVNGIEEMSYVGEWTVEESSGPGALKGEAGLVMKDEAAHHAISYEFDEPINEPEKDLVVQYEVNPEEGLNCGGAYLKLLAEPTHGEMSNSIDYRIMFGPDKCGVNDRVHFIFKHKNPLTGEYSEKHLDSRPASLLKPGITNLYTLIVKPDQTFEVRINGDVVRQGSLFYDFIPPVLPPVEIYDPEDIKPADWVDEPEIPDPNAVKPDDWDEDAPRMIPDPDAVKPEDWLEDEPLYIPDPEAQKPEDWDDEEDGDWIPSEIINPKCIEGAGCGEWKPPMIRNPNYRGPWSPPMIPNPEFIGEWYPRKIPNPDYFDDDHPSHFGPLYGVGFELWTMQPNIRFSNIYVGHSIEDAERLGNETFLPKLKAERELLSKQESMEKQSMHVDEESNQILEKFLDVYDIIKAKLPPNVAEKVDYYVETIIETPEIGIAIVAVLGSLTAVILTCYFYFFASSSPASLSTGTTEAEKEQQEKFKQETETEKIDVSYAPETESPTAKNED

CAL1

Calreticulin

416 amino acids

Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER (By similarity).

Belongs to the calreticulin family.

47.481 kDa

MATQRRANPSSLHLITVFSLLVAVVSAEVFFEESFNDGWESRWVKSEWKKDENMAGEWNHTSGKWNGDANDKGIQTSEDYRFYAISAEFPEFSNKGKNLVFQFSVKHEQKLDCGGGYMKLLSGDVDQKKFGGDTPYSIMFGPDICGYSTKKVHAILTYNDTNHLIKKEVPCETDQLTHVYTFILRPDATYSILIDNVEKQSGSLYSDWDLLPPKTIKDPSAKKPEDWDEKEFIDDPEDKKPEGYDDIPEEITDPDAKKPEDWDDEEDGEWTAPTIPNPEYKGPWKPKKIKNPNYKGKWKAPLIDNPDFKDDPDLYVFPKLKYVGVELWQVKSGTLFDNIVICDDPEYAKAIAEETWGKQKDAEKAAFEEAEKKREEEESKAAPADSDAEEDDDADDDSDDADDKSESKDDEAHDEL

CAL1

Calmodulin

149 amino acids

Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.

Belongs to the calmodulin family.

16.862 kDa

MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK

CAL1

Defensin-like protein CAL1

80 amino acids

Plant defensin-like protein involved in accumulation of cadmium (Cd) in rice leaves. Mediates Cd efflux from cytosol into extracellular spaces via chelation. This drives Cd secretion from xylem parenchyma cells into the xylem vessels, hence lowering Cd levels in cytosol meanwhile promoting Cd translocation from roots to shoots.

Belongs to the DEFL family.

8.784 kDa

MAPSRRMVASAFLLLAILVATEMGTTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKVC