BZR1

Protein BRASSINAZOLE-RESISTANT 1

336 amino acids

Transcriptional repressor that binds to the brassinosteroid (BR) response element (BRRE) 5'-CGTG(T/C)G-3' in gene promoter. Regulates positively the brassinosteroid-signaling pathway. Mediates downstream growth responses and negative feedback regulation of brassinosteroid biosynthesis. Promotes growth. Modulates ovule initiation and development by monitoring the expression of genes related to ovule development (e.g. HLL, ANT, and AP2).

Belongs to the BZR/LAT61 family.

36.486 kDa

MTSDGATSTSAAAAAAAAAAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKALCVEAGWVVEEDGTTYRKGCKPLPGEIAGTSSRVTPYSSQNQSPLSSAFQSPIPSYQVSPSSSSFPSPSRGEPNNNMSSTFFPFLRNGGIPSSLPSLRISNSCPVTPPVSSPTSKNPKPLPNWESIAKQSMAIAKQSMASFNYPFYAVSAPASPTHRHQFHTPATIPECDESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQMSPNTAAFQEIGQSSEFKFENSQVKPWEGERIHDVGMEDLELTLGNGKARG

BZR1

Protein BZR1 homolog 1

298 amino acids

Positive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid biosynthetic genes. May act as transcriptional repressor by binding the brassinosteroid-response element (5'-CGTGCG-3') in the promoter of GRAS32 (AC Q9LWU9), another positive regulator of brassinosteroid signaling (By similarity).

Belongs to the BZR/LAT61 family.

31.909 kDa

MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK

BZR1

Protein BZR1 homolog 1

298 amino acids

Positive brassinosteroid-signaling protein. Mediates downstream brassinosteroid-regulated growth response and feedback inhibition of brassinosteroid (BR) biosynthetic genes (PubMed:17699623, PubMed:19220793). May act as transcriptional repressor by binding the brassinosteroid-response element (BREE) (5'-CGTG(T/C)G-3') in the promoter of DLT (AC Q9LWU9), another positive regulator of BR signaling (PubMed:19220793). Acts as transcriptional repressor of LIC, a negative regulator of BR signaling, by binding to the BRRE element of its promoter. BZR1 and LIC play opposite roles in BR signaling and regulation of leaf bending (PubMed:22570626).

Belongs to the BZR/LAT61 family.

31.909 kDa

MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALCREAGWVVEDDGTTYRKGCKPPPSSAGGASVGMSPCSSTQLLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK