BSD2

Metal homeostatis protein BSD2

321 amino acids

Required for homeostasis of heavy metal ions such as cadmium, cobalt and copper. Controls metal ion transport and prevents metal hyperaccumulation by negatively regulating the SMF1 and SMF2 metal transport systems. Under manganese-replete conditions facilitates trafficking of SMF1 and SMF2 metal transporters to the vacuole where they are degraded.

Belongs to the BSD2 family.

35.764 kDa

MPEQELLIGQEMNTLHAGSSTDGINVGNAGRTRDTQTGVEGETEIGSDEEDSIEDEGSSSGGNSTTERLVPHQLREQAARHIGKIGRHFNILDRLFKKRTQQSSDIQQGAMFDGVFSNLSAKPDTTETEGNNEQDIPPTYDEAAADMAPSYYGMDLNNSDIYYDEICIEGLPVGNIANLLWNIIVSTSFQFIGFLITYILHTSHAAKQGSRFGLGLTFIGYGYSMIPNDVTSKVGKNKSLNRMELEDPNEFDDVRLNSQSTTQDKFESHLNHGLDEEKQNIPWLAVFVAFLGLFITLKSIYDYIQVKKLEKKYLNQSQNQA

BSD2

Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic

156 amino acids

Chloroplast chaperone required for RuBisCo biogenesis and translational regulation of the RuBisCo large subunit (RbcL) (PubMed:25124725). Stabilizes an end-state assembly intermediate of eight RbcL subunits until the small subunits (RBCSs) become available to produce a complete stable RuBisCo complex containing eight small and eight large subunits (By similarity).

Belongs to the BSD2 chaperone family.

16.059 kDa

MNSAALNARTASVAPQPQACHACKCRQLLSRRVPPAQRQVECSAIAPETLQDIIVGGAVVGAVSVALYAGLKKDPVPCSLCQGTGGIRCFACGGDGRNATVSRDDLYDSKALGGGVAPPKRDPLGRTINPRDCKVCRGAGLVLCSQCKGTGFQSAF

BSD2

Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic

136 amino acids

Chloroplast chaperone required for RuBisCo biogenesis and translational regulation of the RuBisCo large subunit (RbcL) (PubMed:29217567). Stabilizes an end-state assembly intermediate of eight RbcL subunits until the small subunits (RBCSs) become available to produce a complete stable RuBisCo complex containing eight small and eight large subunits (PubMed:29217567).

Belongs to the BSD2 chaperone family.

14.546 kDa

MANSLCFFSSPPTFCFQSPSKNPKPSHFFSTNDNTSSLVQKRELLQTSRSQSFEVKAANNNPQGTKPNSLVCANCEGEGCVACSQCKGGGVNLIDHFNGQFKAGALCWLCRGKKEVLCGDCNGAGFIGGFLSTFDE

BSD2

Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic

129 amino acids

Chloroplast chaperone required for RuBisCo complex biogenesis and translational regulation of the RuBisCo large subunit (RbcL) (PubMed:10330470, PubMed:12239405). Stabilizes an end-state assembly intermediate of eight RbcL subunits until the small subunits (RBCSs) become available to produce a complete stable RuBisCo complex containing eight small and eight large subunits (By similarity). Involved in the differentiation of bundle sheath cells, especially chloroplast structure (PubMed:12239405).

Belongs to the BSD2 chaperone family.

13.719 kDa

MAATASLTTTAPSPPALLKASAPLLISFRPVSRHCKNLCIKTKATENDQSAKKHQKVKSILCQDCEGNGAIVCTKCEGNGVNSVDYFEGRFKAGSLCWLCRGKREILCGNCNGAGFLGGFLSTFDETAQ