About Products Protein Database Contact

BRA0891

Gene
BRA0891
Protein
UPF0434 protein BRA0891/BS1330_II0884
Organism
Brucella suis biovar 1 (strain 1330)
Length
64 amino acids
Similarity
Belongs to the UPF0434 family.
Mass
7.126 kDa
Sequence
MDDKVETGNIDVRLLELLVCPLTKGPLEYDAERSELVSRKARLAYPVRGGIPIMLPSEARSLTE