About Products Protein Database Contact

BCAH820_1916

Gene
BCAH820_1916
Protein
UPF0176 protein BCAH820_1916
Organism
Bacillus cereus (strain AH820)
Length
319 amino acids
Similarity
Belongs to the UPF0176 family.
Mass
36.761 kDa
Sequence
MATTKPYRVLLYYMYTTIENPEEFAAEHLEFCNSLELKGRILVAKEGINGTCSGTVEQTEKYMEAMNNDPRFDGIVFKIDEADGHAFKKMHVRPRPELVTLRLEDDINPHEITGKYLEPKDFYEAMKQEDTVIIDARNDYEFDLGHFKGAIKPDIESFRELPDWIRENKEVLEGKKILTYCTGGIRCEKFSGWLVREGYEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQKEHVIVGKDHFTGEPCERYVNCANPECNKKILCSEENEAKYLRACSHECRVSPRNRYVIQHELTEEQVAAALEKIEAGK