About Products Protein Database Contact

BBR

Gene
BBR
Protein
Protein Barley B recombinant
Organism
Hordeum vulgare
Length
350 amino acids
Function
Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Positively regulates the homeotic gene BKN3.
Similarity
Belongs to the BBR/BPC family.
Mass
38.978 kDa
Sequence
MDDDGSLSIRNWGFYETMKGNLGLQLMPSVTGGHRDTKPLLPNGTFLQHHTPPHHPPHSHHPRDYGNGEPSGGMPAEPPAIHMDFVRNEAWMHPSQHQHQHQHQHQHQHQHQHQLQHQHQHQHSRELKVLNAVPVGPAPHIGHPGHAVHHHPTGFGMMPDARGAHTLQMMQPQEPPVPDEEKITPPLVEDHSVVGSKPPVKKRQQGRQPKVPKPKKPKKDATPGEDGAPKARAPRSRGPLKPVEMVINGIDFDISRIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMNTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLNNPIDLKTFWAKHGTNKFVTIR

Gene
BBR
Protein
E3 ubiquitin ligase BIG BROTHER-related
Organism
Arabidopsis thaliana
Length
340 amino acids
Function
E3 ubiquitin-ligase probably involved in organ size regulation.
Mass
37.263 kDa
Sequence
MPMENDNGPHVGNVVVTAEQATKINETDGRLPENRQTGVVSDTGSGSERGEQGVGESAVAVAVPVEESGSISVGELPAPRSSSARVPFTNLSQIDADLALARTLQEQERAYMMLTMNSEISDYGSWETGSYVYDEDEFDDPENEDEDDDEDEYETDDDPQEDGLDVNVHANEDDQEDDGNSDIEEVAYTDDEAYARALQEAEERDMAARLSALSGLANRVVEDLEDESHTSQDAWDEMDPDELSYEELLALGDIVGTESRGLSADTIASLPSKRYKEGDNQNGTNESCVICRLDYEDDEDLILLPCKHSYHSECINNWLKINKVCPVCSAEVSTSTSGQS