bax

Protein bax

274 amino acids

30.868 kDa

MILTPIRRYGAMILMLLTLVFSSEVLAKTHTTTASQKSHLTKASNKQVSSKQEYSRNSAKSSSLPDLRKYPSGTPRKKAFLRTVMPYITSQNAAITAERNWLISKQYQGQWSPAERARLKDIAKRYKVKWSGNTRKIPWNTLLERVDIIPTSMVATMAAAESGWGTSKLARNNNNLFGMKCMKGRCTNAPGKVKGYSQFSSVKESVSAYVTNLNTHPAYSSFRKSRAQLRKADQEVTATAMIHKLKGYSTKGKSYNNYLFAMYQDNQRLIAAHM

BAX

Apoptosis regulator BAX

192 amino acids

Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. BAX deficiency leads to lymphoid hyperplasia and male sterility, because of the cessation of sperm production (By similarity). Interacts (via a C-terminal 33 residues) with NOL3 (via CARD domain); inhibits BAX activation and translocation and consequently cytochrome c release from mitochondria (By similarity).

Belongs to the Bcl-2 family.

21.259 kDa

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELGLEQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

BAX

Apoptosis regulator BAX

192 amino acids

Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM) (PubMed:21458670). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.

Belongs to the Bcl-2 family.

21.184 kDa

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Bax

Apoptosis regulator BAX

192 amino acids

Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. BAX deficiency leads to lymphoid hyperplasia and male sterility, because of the cessation of sperm production.

Belongs to the Bcl-2 family.

21.395 kDa

MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Bax

Apoptosis regulator BAX

192 amino acids

Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.

Belongs to the Bcl-2 family.

21.351 kDa

MDGSGEQLGGGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG