BAS4

Biotrophy-associated secreted protein 4

102 amino acids

Secreted effector involved in biotrophic colonization of plant cells (PubMed:19357089). Participates in transition from the biotrophic to the necrotrophic phase of Magnaporthe oryzae (PubMed:31049006). Elicits rice basic defense responses during the early stage of interaction and promotes cell death in the late stage of compatible interaction (PubMed:19357089).

11.088 kDa

MQLSFSAIAILLAFAVNHATADSHQNLVCVRTYPDNNSAENLEATRCACDWLKKNGKCDDCTIWENRLCHSDAKSLDGNEFEDACVRKCPNLGATGSSIPPA