B9d2

B9 domain-containing protein 2

177 amino acids

Probable component of the tectonic-like complex (also named MKS complex), a complex localized at the transition zone of primary cilia (PubMed:27646273, PubMed:25447994, PubMed:27577095). Has a role in ciliary structure and function (PubMed:27646273).

Belongs to the B9D family.

19.746 kDa

MAEVHIIGQILKAVDFAEPHLYCKWSLQSGNAWRLVQGEVQGQSHVASHRLQSSSDFAQPLDIHLSTASVQGWPRLLVEVYAVNVLQQSWPVGYGFVHVPSTPGTHRLEIGTWKVAPNGLWQSLRERFGGGGAALSKTDLLYSGVERYKLQTLSSGKVIVELNLIFRKFDEYGVEFK

b9d2

B9 domain-containing protein 2

176 amino acids

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Belongs to the B9D family.

19.767 kDa

MAEVHIIGQIIGASGFPQHSLFCKWGLHTGGAWKLLSGVVEGQTQVDHPQNDDMAFWSHPIDMHFATKGLQGWPKLHLQVWHQDTFGRNELYGYSFLHIPSTPGTHTLLSPTWRPLGTWQEQICQMFVGGGPQLKSASLIYGGSDRYRLQTVAMGQVHLELTVILRNFERYGVESS

B9D2

B9 domain-containing protein 2

175 amino acids

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Belongs to the B9D family.

19.358 kDa

MAEVHVIGQIMGATGFSESSLFCKWGVHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARAFVGGGPQLLHGDAIYSGADRYRLHTTSGGTVHLELSLLLRHFDRYGVEC

b9d2

B9 domain-containing protein 2

175 amino acids

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Belongs to the B9D family.

19.823 kDa

MAELHIIGQIIGATGFPQNSLFCKWGVHTGGAWRLLSGLREGQTQVDMPQTGDMAYWSHPIDLHYTTKGLQGWPKLHLQVWHQDSFGRCQLYGYGYIHVPSSPGQHRLQCVTWRPLGSWQDQLSEMFVGGGPQLRSPDLIYSGADRYRLHTVGMGTVELELCIILRHFDRYGVES

B9D2

B9 domain-containing protein 2

175 amino acids

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Belongs to the B9D family.

19.261 kDa

MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC

B9d2

B9 domain-containing protein 2

175 amino acids

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Belongs to the B9D family.

19.25 kDa

MAEVHVIGQIIGATGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVEC

B9d2

B9 domain-containing protein 2

175 amino acids

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes.

Belongs to the B9D family.

19.208 kDa

MAEVHVIGQIIGATGFSEGSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQTGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARAFVGGGPQLLHADTIYSGADRYRLHTAAGGTVHLGIGLLLRHFDRYGVEC