About Products Protein Database Contact

Avi_1324

Gene
Avi_1324
Protein
UPF0260 protein Avi_1324
Organism
Agrobacterium vitis (strain S4 / ATCC BAA-846)
Length
159 amino acids
Similarity
Belongs to the UPF0260 family.
Mass
18.133 kDa
Sequence
MTSEPYWKTKRLDEMNTVEWEALCDGCGLCCLNKLEDWESGEVVFTSVACRLLDGESCRCKDYPNRQATVPDCIQLTPDQVEDIAWLPPSCGYRLVHEGRDLYWWHPLVSGDPETVHQAGISARGRTVSEEHVSVEDFEDYLCDWPMTVLLQAEESGDQ