Avh23

RxLR effector protein Avh23

140 amino acids

Effector that suppresses plant defense responses during the early stages of pathogen infection. Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:21653195). Acts as a modulator of histone acetyltransferase (HAT) in plants. Avh23 binds to the ADA2 subunit of the HAT complex SAGA and disrupts its assembly by interfering with the association of ADA2 with the catalytic subunit GCN5. As such, Avh23 suppresses H3K9 acetylation mediated by the ADA2/GCN5 module and increases plant susceptibility (PubMed:28318979).

Belongs to the RxLR effector family.

15.47 kDa

MRLTYFLTVIVVATLHAGGTALATAEAPNHAAIVNVASADNVHSLDTTAEIGGRMLRKVKEDTVSKKDHEERGPGAILERQTAFVKKLFSRQNAIVNRAQGAFQRQNAFVNRDQGAFQRQNAFVKRAIQRQNHFKLSDNA

Avh23

RxLR effector protein Avh23

140 amino acids

Effector that suppresses plant defense responses during the early stages of pathogen infection. Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:21653195). Acts as a modulator of histone acetyltransferase (HAT) in plants. Avh23 binds to the ADA2 subunit of the HAT complex SAGA and disrupts its assembly by interfering with the association of ADA2 with the catalytic subunit GCN5. As such, Avh23 suppresses H3K9 acetylation mediated by the ADA2/GCN5 module and increases plant susceptibility (PubMed:28318979).

Belongs to the RxLR effector family.

15.47 kDa

MRLTYFLTVIVVATLHAGGTALATAEAPNHAAIVNVASADNVHSLDTTAEIGGRMLRKVKEDTVSKKDHEERGPGAILERQTAFVKKLFSRQNAIVNRAQGAFQRQNAFVNRDQGAFQRQNAFVKRAIQRQNHFKLSDNA

Avh23

RxLR effector protein Avh262

123 amino acids

Effector that suppresses plant defense responses during the early stages of pathogen infection. Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:21653195, PubMed:27256489). Avh262 stabilizes endoplasmic reticulum (ER)-luminal binding immunoglobulin proteins (BiPs), which act as negative regulators of plant resistance to Phytophthora. By stabilizing BiPs, Avh262 suppresses ER stress-triggered cell death and facilitates Phytophthora infection (PubMed:27256489).

Belongs to the RxLR effector family.

13.259 kDa

MLPVAVVLVVFAVAVTSAESIHQVNPLPRRRRLKGTEEKGHHTNVNDEERVISLESASDLISKLKVKINAKLLAGDSAKPATLSKAQVASVAKEVVKEVKKTPKVWPPPMIKKGVRRGAGGVR