About Products Protein Database Contact

Athe_2116

Gene
Athe_2116
Protein
UPF0210 protein Athe_2116
Organism
Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320)
Length
452 amino acids
Similarity
Belongs to the UPF0210 family.
Mass
48.329 kDa
Sequence
MFTSQEIIETINMVKQSNLDIRTITVGISLFDCSSDIPQRFIDNMRKKIIKYAGNLKNVANEIEDMFGLPIVNKRVALTPISLLTFSYSYEDLIEVALAIDEIAKELEVDLIGGYSAAVHKNYDENTKKFISSIPDALASTDRLCSSVDVGTTRSGINLDVIAHLGFIIKDIAQKTKDKDSFGCARFVVFANAPDDNPFMAGAFHGTGEGDCCINVGISGPGVVKRALEEKKDASIDEIYETIKKMAFKITRAGQLVLQYASKKLQIPAGIVDLSLAPTPKVGDSIAEILEEIGVEKVGGYGTTFALALLNDAVKKGGAMAASFTGGLSGAFIPVSEDSGMVKGVESGTLSLEKLEAMTSVCSVGLDMIVVPGDVEAEVISAMIADEIAIGVYNNKTTAVRVIPAYGKKEGDEVNFGGLLGGSKVMKINRSSPKRLIERGGRVPPPIISLRN