About Products Protein Database Contact

At2g30000

Gene
At2g30000
Protein
PHD finger-like domain-containing protein 5A
Organism
Arabidopsis thaliana
Length
110 amino acids
Similarity
Belongs to the PHF5 family.
Mass
12.429 kDa
Sequence
MAKHHPDLIMCRKQPGIAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSFQGRCVICGGVGISDAYYCKECTQQEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKR