About Products Protein Database Contact

At2g29860

Gene
At2g29860
Protein
Putative F-box/kelch-repeat protein At2g29860
Organism
Arabidopsis thaliana
Length
240 amino acids
Mass
27.326 kDa
Sequence
MVLLSEIPGGSNGDDPNMNPQELPEELIESIVAPIPRCYYPSLSLLSRAFRHVITSQQLFVTRSGLGFKEPVLYAFIGCTPYTTPRWFILRRSNIPLQLRRLNSLPHMFPGAAVVTIGYKIYVMGGYNYQPVSTVIIIDCRFHTWHYLQDMQRARYHATPGVIDGRIYVIGGRKKQDADWVEVFDVTTESWETVPTQCPNEASENGLFVTYAVMQGRILGVFLLTNQDKVYGSHWELYVS