About Products Protein Database Contact

At2g15640

Gene
At2g15640
Protein
F-box protein At2g15640
Organism
Arabidopsis thaliana
Length
426 amino acids
Mass
49.576 kDa
Sequence
MNPSTITNDLTVEILSRLPAKSVARFHCVSKQWGSIFGSPYFKELFLTRSSTKPRLLFAMAEKVNEEKNCVWRFFSTPQLENPYEKSSSTLVAAAEFHVKFSPDKLYICHCYDLKYFSIGYASGLIYLYGDRGEATPLICNPTTGRYAILPNRYTYRKAYSFFGFDPIDKQYKALSIFYPSGPGHSKILTFGAGHMKWRKINCPLRYDRHDIKSEGICINGVLYYLGSTSDCVKDGHGIVSDYVIVCFDIRSEKFTFIDVERFCRLINYKGKLAVIYWEDDVDIYKLYYSDVDEYVEYNINDDDINELRVWVLEDVKKQQWSKYAYTWTDDRFFRRRVSIAGGTASGEIVFSMLKYTPKQPFYVFYFNPERNTLQRVEIQGFGEVLKKTCRVCTFVNHVEDLNVHDFKQLKSVHPPLVDEPDSESD