AADAC

Arylacetamide deacetylase

399 amino acids

Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity (By similarity).

Belongs to the 'GDXG' lipolytic enzyme family.

45.604 kDa

MRKKYFGFLILGVLLAGYIYVPLPDNVEEPWKIMLLNTFLKTSSYLALFGEILGLNHFMKSMALFSRIQGFPPTSDENIIVKDTTFNDIPVRIYVPQQKTKSLRRGLFYIHGGGWCFGSNDYYSYDLLSRWTAERLDAVVISTNYRLAPKYHFPVQFEDVYTALKWFLDPQNLESYGVDPGRIGISGDSAGGNLAAAVAQQLLEDPDVKIKLKVQTLIYPALQNFDFDLPSYRENAHYPVLSKSLMVRFWSEYFTTDRSLKKAMLSNQHIPLESSNLFKFVNWSSLLPEKFKKGHIYKTPTHGSSELAKKYPGILDVKASPLLADDSKLRGLPLTYVITCQYDVLRDDGLMYVTRLQKSGVQVIHNHVEGAFHGTLAFLFTKVGYRAANQYINWLHENL

AADAC

Arylacetamide deacetylase

399 amino acids

Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity.

Belongs to the 'GDXG' lipolytic enzyme family.

45.734 kDa

MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

Aadac

Arylacetamide deacetylase

398 amino acids

Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly (By similarity). Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity.

Belongs to the 'GDXG' lipolytic enzyme family.

45.693 kDa

MGRTIFLLISVVLVAYYIYIPLPDDIEEPWKIILGNTLLKLGGDLASFGELLGLNHFMDTVQLFMRFQVVPPTSDENVTVMETDFNSVPVRIYIPKRKSTTLRRGLFFIHGGGWCLGSAAYFMYDTLSRRTAHRLDAVVVSTDYGLAPKYHFPKQFEDVYHSLRWFLQEDILEKYGVDPRRVGVSGDSAGGNLTAAVTQQILQDPDVKIKLKVQALIYPALQALDMNVPSQQENSQYPLLTRSLLIRFWSEYFTTDRDLEKAMLLNQHVPVEFSHLLQFVNWSSLLPQRYKKGYFYKTPTPGSLELAQKYPGFTDVKACPLLANDSILHHLPMTYIITCQYDVLRDDGLMYVKRLQNTGVHVTHHHIEDGFHGALTLPGLKITYRMQNQYLNWLHKNL

Aadac

Arylacetamide deacetylase

398 amino acids

Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly (By similarity). Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity.

Belongs to the 'GDXG' lipolytic enzyme family.

45.25 kDa

MGKTISLLISVVLVAYYLYIPLPDAIEEPWKVVWETAFVKIGTDLASFGELLGISHFMETIQLLMSFQEVPPTSDEHVTVMETAFDSVPVRIYIPKRKSMALRRGLFYIHGGGWCLGSAAHFSYDTLSRWTAHKLDAVVVSTDYGLAPKHHFPRQFEDVYRSLRWFLQEDVLEKYGVDPRRVGVSGDSAGGNLAAAVTQQLIQDPDVKIKLKVQALIYPALQALDTNVPSQQEGSHFPVLTRSLMVRFWSEYFTTDRGLEKAMLLNQHVPMESSHLLQFVNWSSLLPERYKKSPVYKNPTPGSSELAQKYPGFIDVKACPLLANDNILHHLPKTYIITCQYDVLRDDGLMYVKRLQNVGVHVTHHHVEDGFHGTFSFPGLKLSERMKNQYLSWLIKNL

AADAC

Arylacetamide deacetylase

398 amino acids

Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity (By similarity).

Belongs to the 'GDXG' lipolytic enzyme family.

45.329 kDa

GVKTVLLLIVGVLGAYYVYTPLPDNIEEPWRLLWVNAHMKTLTNLALFAEYLGSNIFMNTVKFLTSFQEVPPTSDENVTVTETTFNNVPVRVYVPKRKSKTLRRGLFYIHGGGWCVGSAALSGYDLLSRRTADRLDVVVVSTNYRLAPEYHFPIQFEDVYDALKWFLRQDVLEKYGVDPERVGVSGDSAGGNLAAAVAQQLIKDPDVKIKLKTQSLIYPALQTLDMDLPSYRENAQFPILSKSFMVRLWSEYFTSDRSLEKAMLLNQHVPVESSHLFKFTNWSSLLPEKFKKGHVYNTPTYGSSELARKYPGFLDVRAAPLLADDAQLRGFPLTYVITCQYDVLRDDGVMYVTRLRNAGVQVTHNHIEDGFHGALSYNGFKTGYRVEKQYFEWLRENV