Atpsckmt

ATP synthase subunit C lysine N-methyltransferase

247 amino acids

Mitochondrial protein-lysine N-methyltransferase that trimethylates ATP synthase subunit C, ATP5MC1 and ATP5MC2. Trimethylation is required for proper incorporation of the C subunit into the ATP synthase complex and mitochondrial respiration (PubMed:29444090, PubMed:30530489). Promotes chronic pain (PubMed:29444090). Involved in persistent inflammatory and neuropathic pain: methyltransferase activity in the mitochondria of sensory neurons promotes chronic pain via a pathway that depends on the production of reactive oxygen species (ROS) and on the engagement of spinal cord microglia (PubMed:29444090).

Belongs to the FAM173 family.

27.397 kDa

MERVGTPEEERQAGPVLPTSLESDSSKRTSWGFLITGVVGGALLTVYAVATPFITPALRKVCLPFVPATSKQVENVVRMLRHRRGPLVDIGSGDGRIVIAAAKEGFPAVGYELNPWLVWYSRYRAWRAGVHGSAKFYISDLWKVTFAQYSNVVIFGVPQMMPQLEKKLELELEDGARVIACRFPFPRWTPDHTTGEGIDTVWAYDMSAQRGRGGRPNQEWVGQKNLSETAGLQASSSETRSKLLDVE

ATPSCKMT

ATP synthase subunit C lysine N-methyltransferase

233 amino acids

Mitochondrial protein-lysine N-methyltransferase that trimethylates ATP synthase subunit C, ATP5MC1 and ATP5MC2. Trimethylation is required for proper incorporation of the C subunit into the ATP synthase complex and mitochondrial respiration (PubMed:29444090, PubMed:30530489). Promotes chronic pain (PubMed:29444090). Involved in persistent inflammatory and neuropathic pain: methyltransferase activity in the mitochondria of sensory neurons promotes chronic pain via a pathway that depends on the production of reactive oxygen species (ROS) and on the engagement of spinal cord microglia (PubMed:29444090).

Belongs to the FAM173 family.

26.11 kDa

MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA

atpsckmt

ATP synthase subunit C lysine N-methyltransferase

226 amino acids

Mitochondrial protein-lysine N-methyltransferase that promotes chronic pain. Involved in persistent inflammatory and neuropathic pain: methyltransferase activity in the mitochondria of sensory neurons promotes chronic pain via a pathway that depends on the production of reactive oxygen species (ROS) and on the engagement of spinal cord microglia. Protein-lysine N-methyltransferase activity is dependent on S-adenosyl-L-methionine.

Belongs to the FAM173 family.

25.478 kDa

MSKSRKESKSLEEYSIVSSTSRPKKKKWGLVATGVIGGTLVALYAVATPFVAPALRKLCLPYVPATTTQVKNVLKMLRSRTGIVVDIGSGDGRIVIAAAKEGFQAVGYELNPWLVWYSRFRAWREGVHHHTRFYVSDLWKVSFSRYRNVVIFGVPQMMPQLEKKLQTELQDAARVIACRFPFPNWVPDHIFGEGVDTVWTYDLGAFRKVSDLKQVASKHCILDTTV

Atpsckmt

ATP synthase subunit C lysine N-methyltransferase

216 amino acids

Mitochondrial protein-lysine N-methyltransferase that trimethylates ATP synthase subunit C, ATP5MC1 and ATP5MC2. Trimethylation is required for proper incorporation of the C subunit into the ATP synthase complex and mitochondrial respiration (Probable). Promotes chronic pain. Involved in persistent inflammatory and neuropathic pain: methyltransferase activity in the mitochondria of sensory neurons promotes chronic pain via a pathway that depends on the production of reactive oxygen species (ROS) and on the engagement of spinal cord microglia (By similarity).

Belongs to the FAM173 family.

24.053 kDa

MERGETPEEERQSGCVLPTSPESDSLKTSNWGFLITGVIGGALVTVYAVTTPFIAPALRKVCLPFVPATSRQVENVVKMLQHRRGPLVDIGSGDGRIVIAAAKAGFPAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFAQYSNVVIFGVPQMMPQLEKKLEFELEDGARVIACRFPFPHWTPDHTTGEGIDTVWAYDMSACRTQGKRA