ATP6V1E2

V-type proton ATPase subunit E 2

226 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome (By similarity).

Belongs to the V-ATPase E subunit family.

26.171 kDa

MALSDVDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSTLRNQARLKVLRARNDLISELLNDAKLRLSRIVTDPEFYQGLLDKLVLQGLLRLLEPVVIVRCRPQDHFLVEAAVQRAIPQYTAVSHRCVEVQVDKEVQLATDTTGGVEVYSSDQRIMVSNTLESRLDLLSQQKMPEIRKALFGANANRKFFV

ATP6V1E2

V-type proton ATPase subunit E 2

226 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome (By similarity).

Belongs to the V-ATPase E subunit family.

26.074 kDa

MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKILMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKVSNTLESRLDLSAKQKMPEIRMALFGANTNRKFFI

Atp6v1e2

V-type proton ATPase subunit E 2

226 amino acids

Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.

Belongs to the V-ATPase E subunit family.

26.307 kDa

MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKLVLQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGGVEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNTSRKFFT