About Products Protein Database Contact

ATHX

Gene
ATHX
Protein
Thioredoxin X, chloroplastic
Organism
Arabidopsis thaliana
Length
182 amino acids
Function
Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.
Similarity
Belongs to the thioredoxin family.
Mass
19.648 kDa
Sequence
MDSIVSSSTILMRSYLTPPVRSCSPATSVSVKPLSSVQVTSVAANRHLLSLSSGARRTRKSSSSVIRCGGIKEIGESEFSSTVLESAQPVLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFKDGKEVPGSRREGAITKAKLKEYIDGLLNSISVA