ATG4

Cysteine protease ATG4

1193 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

130.136 kDa

MSSPTSTSPKSSFVFSPTSFPHAAIASNNVRPRTNLPPPPPPDRIPPPKGRSHQQKFKILRKEKDKDRRQPIDLEDDWTIEDVTVNGDGVEQESQYLDDLQPEENELKPGPRFLEMANREEKKEKTSKSRGLVKKTSRLFGRDKDKDRGKPEEPAVTGSSSSTLAAMRQSSSTSTDSTTSRSITSAFTRQNSIQSRRSPRTSFGQAHSRRASQDSQMSWPAPRSIRSSTTSHDPSSDPQNSASSTGVPIPQRQGASMSSLSRYSLPHPNGGTSRSPDTFPNKMSTWFSHLLPVSSGSPPSSSYETSSSIRKQSSVAASLFNAARQKAVDGVRHLLDSEAQPDKCMDTIWVRGVAHPGWRPITPENSTSNLPALEPGGSGGGVEDRRASLSMNGPSPNSLRPSSWKRNTSLPPTGQPQSPAHVHTQASNQTTSPSKGFTGIWNPSTLSLGMPIGGSPNKEKENGSGAESPSKKKSKEIVKWPEQFYDDFKSTVWFTYRNQYAPISSLSPNLLIPSPEAYYASFGPPLDATSPSSLRVTTPTAAAQQSASGSGGWGWSKEERGLTSDAGWGCMLRTGQSLLVNALIHIHLGRDWRVPSTPASFSEATTTQEIAALKDYAKYAQMLSWFLDDPSPLCPFSVHRMALIGKELGKEVGEWFGPSTAAGALKTLANSFAPCGVAVATATDSIIYKSDVYTASNLPSDDWNSISPTFNSSKKKRRGDNEAKEEKWGKRAVLILVGVRLGLDGVNPIYYDSIKALFTFPQSVGIAGGRPSSSYYFVGSQANHLFYLDPHLTRPAIPLQIPPLPVHSAKEKGSTESSSIMSTAEEESEEGVMIRTPETPRSTTPSMFSAPEHVEDEDQEEWGQGSKYKLDVVDADGVEVEGIDDDKGRNEGKMIREEVPKSSFESNGAAQEQPKKQKGFTSTASIDSQVDSQVDPHMLWYTTAYPDPLLRTYHCEKIKKMPLSGLDPSMLLGFVCKDEDDFEDFVERVAQLPKKIFTVQDEMPSWEEDDDAGLESVSEPDFEGDEFEEPGTAKPRFDSSSPVNEDSLKGPRVVSASTTATPLAAKEEDHLDVEEANSTDDDNESIGTTTAAGPMDIARHLNRVDLSSKREQEGDDDDGEWVGGTPSSQGVLVEPPSLKGTPSKSRSSAFEPRYEQNGETEQERPVFPARNRMESWVEPVCEGKEAPNGDNLL

ATG4

Cysteine protease ATG4

1193 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

130.136 kDa

MSSPTSTSPKSSFVFSPTSFPHAAIASNNVRPRTNLPPPPPPDRIPPPKGRSHQQKFKILRKEKDKDRRQPIDLEDDWTIEDVTVNGDGVEQESQYLDDLQPEENELKPGPRFLEMANREEKKEKTSKSRGLVKKTSRLFGRDKDKDRGKPEEPAVTGSSSSTLAAMRQSSSTSTDSTTSRSITSAFTRQNSIQSRRSPRTSFGQAHSRRASQDSQMSWPAPRSIRSSTTSHDPSSDPQNSASSTGVPIPQRQGASMSSLSRYSLPHPNGGTSRSPDTFPNKMSTWFSHLLPVSSGSPPSSSYETSSSIRKQSSVAASLFNAARQKAVDGVRHLLDSEAQPDKCMDTIWVRGVAHPGWRPITPENSTSNLPALEPGGSGGGVEDRRASLSMNGPSPNSLRPSSWKRNTSLPPTGQPQSPAHVHTQASNQTTSPSKGFTGIWNPSTLSLGMPIGGSPNKEKENGSGAESPSKKKSKEIVKWPEQFYDDFKSTVWFTYRNQYAPISSLSPNLLIPSPEAYYASFGPPLDATSPSSLRVTTPTAAAQQSASGSGGWGWSKEERGLTSDAGWGCMLRTGQSLLVNALIHIHLGRDWRVPSTPASFSEATTTQEIAALKDYAKYAQMLSWFLDDPSPLCPFSVHRMALIGKELGKEVGEWFGPSTAAGALKTLANSFAPCGVAVATATDSIIYKSDVYTASNLPSDDWNSISPTFNSSKKKRRGDNEAKEEKWGKRAVLILVGVRLGLDGVNPIYYDSIKALFTFPQSVGIAGGRPSSSYYFVGSQANHLFYLDPHLTRPAIPLQIPPLPVHSAKEKGSTESSSIMSTAEEESEEGVMIRTPETPRSTTPSMFSAPEHVEDEDQEEWGQGSKYKLDVVDADGVEVEGIDDDKGRNEGKMIREEVPKSSFESNGAAQEQPKKQKGFTSTASIDSQVDSQVDPHMLWYTTAYPDPLLRTYHCEKIKKMPLSGLDPSMLLGFVCKDEDDFEDFVERVAQLPKKIFTVQDEMPSWEEDDDAGLESVSEPDFEGDEFEEPGTAKPRFDSSSPVNEDSLKGPRVVSASTTATPLAAKEEDHLDVEEANSTDDDNESIGTTTAAGPMDIARHLNRVDLSSKREQEGDDDDGEWVGGTPSSQGVLVEPPSLKGTPSKSRSSAFEPRYEQNGETEQERPVFPARNRMESWVEPVCEGKEAPNGDNLL

ATG4

Probable cysteine protease ATG4

545 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

60.412 kDa

MSLQRALQYLWDAEPHNTDHVTPLFCLGQVYDADTSLKEVNDDTEEDGIVVPLDTSNDTSWPPDFLADVQSRIWLSYRTGFPLIPKSDGSGTIHLGKLKNMIRGGGFDPRGYTSDVGWGCMIRTSQSLLANALLFRHLGRGWRWNKGDDFVYLSEGNTESRGGESRNGGANKEQETAVSEETAVSEETIISWFLDSPDSPFSIHKFVRHGEKACSTPAGDWFGPSAAGSSIYALCNEFPDSGLKVYYNGNGGGDVYEDELLETGFPLLVLCGLRLGIDNVNPIYWDSLRQMLSLPQSVGIAGGRPFTSHYFFGFQGEQLFYLDPHQPKPAVKTTDKDTTSFHSSRIWKLHLKEMDPSMLVGFYITSEADWETFKGSLTASKEKTSSQIVHIHPSRHNIPSFDEEDEYVSIGGASDDDFVDVTKRARKVAAMTGNTGSGRSSPSILDSHLVTETRDIIESVPPRKRVDNDLTSAPVDVPKPVQKRSQSHGDWEKVEEPEEEMVEVESMKGMQDNGCSAEYGSLVDRDAEADDSTLSTETTDRDWVV

ATG4

Probable cysteine protease ATG4

533 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

59.883 kDa

MYRFLGLGTHPNDDQNKIHVLGRQYDPIKTQETEGKDLDLNSRFQQVLDSIKDGNKKSTTYSQSFIDDVYSKIWLTYRAGFPPIARDKDSPTFTLGALLRGQFDFNEIGFTSDAGWGCMIRTSQSLLANALLFLHLGRDWVFKAKDPANVEHDRIISWFVDIPDEPFSIHNFVQQGIKCCDKKPGEWFGPSAASRAIKNLCKEYPPCGLRVYFSSDCGDVYDTEVRELAYGDSDTFTPILVLLGIRLGVEKVNLYIGDLLRECLSLKQSVGISGRKTSFLALLSIGFQGDYLFYLIPTFPKKALTFGKHGEPVHRLQTKKTDENAAGQYPVFKYWIQIMKQTMMTAMKASKTTASTLKFFRVLMSNQSTHQKVTKLHLSHMDPSMLIGFLITSEDDFNDWKENIGKKDPSHKIVHITETKVSESTSNFQFNSLRSNSIADYDNCSGEDCDSAAIASDSDDFVDLAADFAVTGLEPRTHTGVDDETSSDYVQHFPIRRFSQPVIVSREDVVPTLSEDNGVIALDDKMSGISVGR

ATG4

Probable cysteine protease ATG4

523 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

58.443 kDa

MSLMSDDSEVFVQAPTVANAELNIEAKPEANAQVNAEADSDANLGNNLGEQQTTDESAFGRNIGKFTAFVKEITGSGTEVEEQEKRNNHTISVDPSSNHENTSFEPTTYKILGRTYTSTTDASARVQELLWLSYRCGFEPIPKSDDGPQPITFFPSIVFNRLTLVNLSNLRSLLDKDHFTSDAGWGCMIRTSQNLLANALLRLFHTTGGQPQNFAVTKTEADVIELFQDTLSAPFSLHNFIKAANSLSLNIKPGQWFGPSAASLSIKKLVNDYNLIQQERRSERDSGRDSGHKVPTPNLKLHSKSADSDSDSDSDAISKRNSIPYVYVSENCDLYDDEINAIFELEQRPILFLFPIRLGIEQVNKYYYSSILQILASKFSVGIAGGKPSSSFYFIGYEGEDDLIYFDPHLPQIVQTPVNLESYHTSEYSKLKIDQLDPSMMIGILIETIDEYQEFKMSCFESDNKILHFHPLVTTAPRESSINQSWEEVQGEEEFVNLNIVKNEEDFVDLGSASTQGQNHEPS

ATG4

Probable cysteine protease ATG4

521 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

59.038 kDa

MGFLIAYVFNLSPCSGDEMFETIGLAIIHFEGLNTNRVSKCNQNWHQESKQVAMELIQKVSQGLWELENCDTVNSVVVLGKEYPPVPEQRQEERHENGVNMFQHIFTRQGRWNEEFLADVHTRLHFTYRTRFVPIPRHPNGPSPMSISVMLRDNPLNVIENVLNNPDCFQTDIGWGCMIRTGQSLLANALQRACLGRDFRIDDNAANEHELRIIKWFEDDPKYPFSLHKFVQEGFSLSGKKPGEWFGPSATSRSIQALVAKFPACGIAHCVISTDSGDVYMDEVEPLFRADPSAAVLLLLCVRLGVDVVNEVYWEHIRHILSSEHSVGIAGGRPSSSLYFFGYQDEHLFYLDPHKPQLNLASYQQDLDLFRSVHTQRFNKVHMSDIDPSMLIGILLNGKDDWQLWQQHIASSQIIHLSDSKPVDLMLDHQLESAILGDRYLSEDGQGPSSKVDTGDYIDVGSFVPCTDSSCKINESEDEYQDVKCKNQRIVVVGETTTNGSPEVEVEKVLVEKETIPVRSK

ATG4

Probable cysteine protease ATG4

514 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

57.38 kDa

MAREDASVPRSHDSADASPNSTAKEIPVPQPPLLNLNLNLNMNSGFNLSNWWHQITSIEADSSDDRNNNNSNNGINAAESDSAQSQPIVVLGHSYQTTEEAHEDIIKKLCLTYRYGFERIPRAVNGPSPLSFMQSVIFSKSLLYNLQNFNNFIEKENFTTDVGWGCMIRTSQSLLANTFVRLLDKQSDIIALFNDTYLAPFSLHNFIRVASSSPLKVKPGEWFGPNAASLSIKRLCDGYYDNSTSETILPRINVLISESTDLYDSQIAQLLEPSTETKGLLVLLPVRLGIDSINSYYFSSLLHLLSLEQSVGIAGGKPSSSFYFFGYQDNSLIYMDPHSAQIFSSDIDMSTYYATRYQRVDIGKLDPSMLIGVFIRDLTSYENFKKSCLDAANKIVHFHATERSTVPESRRKNSEFVNINRSDLKDEDYINIDRVNRLDSTDDFIDLGDDYVETNTNLEEATPSAEDTVPVSTLSASESEITTSSYETPTSKDDNSSRASLDVVVLDTTGEQQE

ATG4

Probable cysteine protease ATG4

509 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

56.839 kDa

MASHSLNTLHTVFEYIWDRELPNDDFTNTLTVLGRTYAPGPPPHQEKAPDLRTLFHKFKPDQAADTEASWPREFLRDVHSRIWLTYRSGFPLIKRAEDGPSPLSFGSLIRGTVDLATVTKGFTTDAGWGCMIRTSQSLLANSLLQLRLGRGWRYDQTRECAKHAEIVSWFVDIPTAPFSIHNFVEQGANCAGKKPGEWFGPSAAARSIQVLCEANYDKTGLKVYFTASGDIYEDELFELAQQGAELRPVLILAGIRLGVKNVNPLYWDFLKKTLGWPQSVGIAGGRPSSSHYFFGFQGDYLFYLDPHVPQKALLIASEAPHESPDPNHYVEVESGLDLDSVHTNKIRKLHLDQMDPSMLVGLLVENRASYDALKHSINSHDQGSRFLNVYDSRPVLAAKSSGGLEESEFVDLGVLSMNEYDAIDDCDVGTCSALLRKERAFSHPVLVAMDPEEPEEIDASIHFDKDASILEKDPDRANETFEEIHVSETESRFEPDEPVVVSHDSAAVM

ATG4

Probable cysteine protease ATG4

500 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

54.817 kDa

MKSTRSGSNNWQSAVSGTSPKIATAMEAAISAGAEVSRVGRRILQRIWDPEPTNDRSNNEPVWCLGCSYLLDTKEYGTPPTLTTSTPPADATLTAIVPEPGAGVESEPRRATEKAGVPVNTSNAKAVAPIPVAASGQHQLQVPETPPLSVASSFDSALAYEEPGQDGGWPPAFLDDFESRIWMTYRTGFEVIPRSTDPKAAAALSFTMRFKTSFGDQTGFSSDTGWGCMIRSGQSLLANAMLISRAGRAWRRTTNPDIEREIVCLFADDPRAPYSIQNFVNHGAAACGKYPGEWFGPSATARCIHSLRVYLTRDLPEVYEDNFMSTANPDGNHFHPTLILVSTRLGIDKINPIYHEALISTLQLPQAIGIAGGRPSSSHYFIGAQGQWLFYLDPHHPRPALPYRENPNDYTIEELDSCHTRRLRHLHVEDMDPSMLIGFLIKDEDDWDLWKSSVKHVQGKAIINVSPHDPEHGMGFGRAGAIDEVETLSDEDDTDTVLDL

ATG4

Cysteine protease ATG4

494 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

55.143 kDa

MQRWLQLWKMDLVQKVSHGVFEGSSEEPAALMNHDYIVLGEVYPERDEESGAEQCEQDCRYRGEAVSDGFLSSLFGREISSYTKEFLLDVQSRVNFTYRTRFVPIARAPDGPSPLSLNLLVRTNPISTIEDYIANPDCFNTDIGWGCMIRTGQSLLGNALQILHLGRDFRVNGNESLERESKFVNWFNDTPEAPFSLHNFVSAGTELSDKRPGEWFGPAATARSIQSLIYGFPECGIDDCIVSVSSGDIYENEVEKVFAENPNSRILFLLGVKLGINAVNESYRESICGILSSTQSVGIAGGRPSSSLYFFGYQGNEFLHFDPHIPQPAVEDSFVESCHTSKFGKLQLSEMDPSMLIGILIKGEKDWQQWKLEVAESAIINVLAKRMDDFDVSCSMDDVESVSSNSMKKDASNNENLGVLEGDYVDIGAIFPHTTNTEDVDEYDCFQDIHCKKQKIVVMGNTHTVNANLTDYEVEGVLVEKETVGIHSPIDEKC

ATG4

Cysteine protease ATG4

494 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS.

Belongs to the peptidase C54 family.

55.143 kDa

MQRWLQLWKMDLVQKVSHGVFEGSSEEPAALMNHDYIVLGEVYPERDEESGAEQCEQDCRYRGEAVSDGFLSSLFGREISSYTKEFLLDVQSRVNFTYRTRFVPIARAPDGPSPLSLNLLVRTNPISTIEDYIANPDCFNTDIGWGCMIRTGQSLLGNALQILHLGRDFRVNGNESLERESKFVNWFNDTPEAPFSLHNFVSAGTELSDKRPGEWFGPAATARSIQSLIYGFPECGIDDCIVSVSSGDIYENEVEKVFAENPNSRILFLLGVKLGINAVNESYRESICGILSSTQSVGIAGGRPSSSLYFFGYQGNEFLHFDPHIPQPAVEDSFVESCHTSKFGKLQLSEMDPSMLIGILIKGEKDWQQWKLEVAESAIINVLAKRMDDFDVSCSMDDVESVSSNSMKKDASNNENLGVLEGDYVDIGAIFPHTTNTEDVDEYDCFQDIHCKKQKIVVMGNTHTVNANLTDYEVEGVLVEKETVGIHSPIDEKC

ATG4

Probable cysteine protease ATG4

492 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

55.84 kDa

MSNRDSSEHGDSSNKIASNECNEATKLGFNFTQLWSQITTTYSLIDRNDSNMFNRDERVESEQEKKSVVILGKKYDDISVDDGVIEQDIYSKIWLTYRTGFEPIAKCLDGPQPLSFVQSMVFNRNPISSTFNNFHGLLDNDNFTTDVGWGCMIRTSQALLANTYQLLFLGRGFSYGRDRSPRHDEIIDMFMDEPRAPFSLHNFIKVASESPLKVKPGQWFGPNAASLSIKRLCDNVYESNGTGRVKVVISESSNLYDDIITQMFTTLNPVPDAILVLLPVRLGIDKVNPLYHASVLELLALRQSVGIAGGKPSSSFYFFGYKGNDLLYLDPHYPQFVRNKTSVYDTYHTNSYQKLSVDDMDPSMMIGILIKDINDYEDFKSSCTKSSNKILHFHPTSEKADRRGSLSEFKRKNSEFVCIESKDVQRREDFITIDNVSRDDLNNMEGFIDMADEFDSEIDQNNKDDNFDDDEPVNVSQTSIGEEYTSTAGSRP

ATG4

Cysteine protease ATG4

491 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS.

Belongs to the peptidase C54 family.

53.934 kDa

MDSAVAGAADIGRYGRRIVRMIWDPEPTNDPIANRPAWCLGYEYTLETNITSKTKGEDSKLSTATSSDQQRPPAQANKVPQMPSAQLPTEAAATALSGNTTPPTPEAALEPTKITSQPAAIDTPPDSVDSSFDSSMAYDDVPDDGGWPPAFLNDFESRIWMTYRSGFEPIPRSTDPTASSRMSFAMRLKTMADQQAGFTTDSGWGCMIRTGQSLLANSLLTCRLGRSWRRGQAPDEERKLLSLFADDPRAPYSIHNFVAHGAAKCGKYPGEWFGPSATARCIHALANATENSFRVYSTGDLPDVYEDSFMEVAKPDGKTFHPTLILISTRLGIDKINQVYWESLTATLQLPQSVGIAGGRPSSSHYFVGAQRSDEDQGSYLFYLDPHHTRPALPFHEDPQLYTPSDVDSCHTRRLRRLHIREMDPSMLIGFLILDEENWHAWKSSVKHVQGKSIITVSEHDPSKGSASGRPSAIDEVETLSDDDGDTVLDG

ATG4

Cysteine protease ATG4

487 amino acids

Cysteine protease required for autophagy, which is able to cleave the C-terminal part of ATG8 that may be subsequently converted to a smaller form, with a revealed C-terminal glycine. The C-terminal glycine of ATG8 is conjugated to phosphatidylethanolamine by an amide bond. This conjugated form has the capacity for the binding to autophagosomes (By similarity).

Belongs to the peptidase C54 family.

53.809 kDa

MVLKDLCDRIVAAKCSSKSSTEIVDNTQVPASSKAGSSDSKFPKASLWSTFFTSGFSVDETYSESSSSEKKTVHSRNSGWAAAVRKVVSGGSMRRFQERVLGSCRTDVSSSDGDIWLLGVCHKISQHESTGDVDIRNVFAAFEQDFFSRILITYRKGFDAIEDSKYTSDVNWGCMLRSSQMLVAQALLFHKLGRSWRKTVDKPVDKEYIDILQLFGDSEAAAFSIHNLLQAGKGYGLAVGSWVGPYAMCRTWEVLARNQREKNEQGEQLLPMAIYVVSGDEDGERGGAPVVCIEDACKRCLEFSRGLVPWTPLLLLVPLVLGLDKVNLRYIPLLQSTFKFPQSLGILGGKPGASTYIIGVQNDKAFYLDPHEVKPVVNITGDTQEPNTSSYHCNISRHMPLDSIDPSLAIGFYCRDKDDFDDFCSRATKLAEESNGAPLFTVAQSRSLPMQVTSNSVSGDDTRFEEDDSLSMNLVNDAGNEDDWQFL

ATG4

Probable cysteine protease ATG4

483 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

54.515 kDa

METIHNISNRLQEVLATNKSVNVDTDNDSLSSNQEDNEVEKVRHLVVILGEKYSYAVDRNTGINALMQWFTTNSEIPEEILNAIRSKLNFTYRTNFEPIERAPDGPSPINPLIMLRINPIDAIENVFNNRECFFTDVGWGCMIRTGQSLLGNALQRVKSTVKDQPYIYEMDDTKEITDLFKDNTKSAFSLQNFVKCGRIYNKIAPGEWFGPATTATCIRYLIQENPCYGIEACYISVSSGDIFKENIQGMIDRYPNGNILILLGIKLGLDSVHERYWGEIKTMLESPFSVGIAGGRPSSSLYFFGYFDDTLLFFDPHNSQTALIDDFDESCHTENFGKLNFSDLDPSMLLGFLLPCSKWDEFQEFTSLLTIVNVLDGMDQYRDPDLNSNDIGNVELSPQLKLSQTPDAITDDDYVDIGALIQGNSMNINDRDNGYQEVQCKNQQIVIMDSLNETKPLEIEKVLVGQGTNLVNATTPCREAFPK

ATG4

Cysteine protease ATG4

469 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy (By similarity). Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (By similarity). Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine (By similarity). ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy (By similarity). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity). Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components (By similarity). ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity). Autophagy is required for proper vegetative growth, asexual/sexual reproduction, and full virulence (PubMed:28894236). Autophagy is particularly involved in the biosynthesis of deoxynivalenol (DON), an important virulence determinant (PubMed:28894236).

Belongs to the peptidase C54 family.

52.489 kDa

MERAMANVDLGPYRRIVQIFWDPEPTNDVVHDQPVWCLGRSYRLNGKKNIKADDHHPQTPPSVLKAETETQEAHDTAQPPNPPTNAPDTPPDSISSSFSSSLAYDDPVVDGGWPSGFISDFESKIWMTYRSEFEPIPRSTNPQATSALSLSMRLKSQLGDQSPFSSDSGWGCMIRSGQSMLANTIAMVRLGRGDWRRGESVEEECRLLKDFADDPRAPYSIHSFVRHGASACGKYPGEWFGPSATARCIQALTNSHESSIRVYSTGDGPDVYEDEFMQIAKPPGEDFHPTLVLVGTRLGIDKITPVYWEALIAALQMPQSESQGKYYQYITRTFSALTIRSGRPSSSHYFIGAQGSFLFYLDPHHTRVALPYHEDPIEYTSEEIASCHTPRLRRIHVREMDPSMLIGFLIQNEVDWQELKRNVKHVQGKSIIHITDRNAVLGGSSEGRESAIDEVETLSDDDTDTIHEA

ATG4

Probable cysteine protease ATG4

467 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

51.812 kDa

MNDFERFGRNVVRTFYDPPPCNESNEPIWLLGQRYDSRPPLPKPAPSDSSTTATATAQAERNEDESWIRTSIDDKERKEAPNGEDPTQYGNWPSAFLDDFESRVWMTYRSGFSPIQKSQDPKATSAMSFRVRMQNLASPGFTSDAGFGCMIRSGQCILANALQILRLGRDWRWQENHADKDHAEILSLFADDPQAPFSIHRFVEHGAAVCGKYPGEWFGPSAAARCIQDLANKHREAGLKVYVSGDGADVYEDKLKQVAVDEDGLWQPTLILVGTRLGIDKITPVYWEALKASLQIPQSIGIAGGRPSASHYFVGVQGNNFYYLDPHSTRPLLPFHPPSLAAATSDTPNLTASTTSVSSTTSSTTIVPPADSIPAPSDPRQSLYPPSDLSTCHTRRIRRLQIREMDPSMLLAFLVTSEADYQDWKEGVQGVQGKSVVHVQDKEPPPRGQEREGAIDEVESWDEDGLQ

ATG4

Probable cysteine protease ATG4

459 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

51.065 kDa

MADVSQRTQQAVDTAMAGAAEMSRYGRRLLNMLWDPEPTNDRSLNRPVWCLGCSYTNEPTTVDRPDQDASSTVRATLPTTPSTTTLPYPLKAVPTTPPESSSSSFSSSLAYDELLEDAGWPIAFLDDFESRVWMTYRSEFEPISKSNDPRASAALSFAMRLRTLADQGGFSSDTGWGCMIRSGQSLLANTLVICQLGRDWRRGKAARQEREILARFADDPRAPYSLHNFVRHGAVACGKFPGEWFGPSATARCIQALANSNESSLRVYSTGDLPDVYEDSFMAVAKPDGETFHPTLILVGTRLGIDKINQVYWEALTATLQMPQSVGIAGGRPSASHYFIGAQRSGDAYEPGSYLFYLDPHCTRPALPFHEDVDQYTSDDINTCHTRRLRRLHVRDMDPSMLIGFLIKDEDDWDMWKDSVKYVQGKTIINVADHDPARGMPAEREAAIDEVETLKGEFV

ATG4

Cysteine protease ATG4

451 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy (PubMed:26442587). Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (By similarity). Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine (PubMed:26442587). ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy (PubMed:26442587). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity). Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components (By similarity). ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

51.288 kDa

MEFLTKITQQLGLVGEIDKVGSVFVLGEEYRPYIFKTQGKADDAETAFGSFLGNAQTNPQLLSDIETRIFFTYRTQFTPIPRDEEGPSPINLTLFFRDNPINTLENVLTDPDSFYSDIGWGCMIRTGQSLLANAIQRVKQTREFRVNLENIDIKEMSIIQWFQDDWKYPLSLHNFVKVEGKKSGMKPGQWFGPSSTARSIQSLINDFPDCGIDRCLISPQSADIYEDEMIRVFEENKRANVLLLFATRLGVNEINSIYWSDIFQILKSSYSVGIAGGKPSSSLYFFGYQNDYLFYLDPHQTQSSSLDMDDNSYYRSCHGHRFSKIHISETDPSMLLGMLISGKAEWDLFKDEFKNSRIIQFVASKPSDDIYEGVDLSPGSVSVHSIQSDLQDTGDYIDVGNFMSEKANSSQPSKNEEFENVKCKNQRILICENPSETEIEQVLVEDSTTDN

ATG4

Probable cysteine protease ATG4

450 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

51.121 kDa

MEFLSRISQHLGIVEDVDRDGTVFILGKEYAPLNNKSRTDVETDDSALESLINIVSLNPGLLSDVHSRVFFTYRTQFTPIRRNENGPSPINFTLFFRDNPINTLENALTDPDSFYSDIGWGCMIRTGQALLANAIQRVKLAREFRINASRIDDNELNLIRWFQDDVKYPLSLHNFVKAEEKISGMKPGQWFGPSATARSIKTLIEGFPLCGIKNCIISTQSADIYEDEVTRIFHKDRDANLLLLFAVRLGVDKINSLYWKDIFKILSSPYSVGIAGGKPSSSLYFFGYQNENLFYLDPHNTQQSSLMMDDLEFYRSCHGHKFNKLHISETDPSMLLGMLISGKNEWDQFHTYFRDSQIIQFLTTRPENDLYQSANMSVGSDSIHSLESDIQDTGEYVDVGTLVSGKQMSSPQPKDEEFEDVKCKSQRIIVCEDPADPEVEQVLVEDSSSC

ATG4

Probable cysteine protease ATG4

448 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

49.557 kDa

MEVALAVGAEASRVSRRILQKIWDPEPINDRDSNEPVWCLGRSYKLAPETPSPVTTATSPVDGAIDAAPAPIATPGTTNRQAIDTPPDSLASSFDSSLAYDNRNQDSGWPPAFLDDFGSRIWMTYRTGFEPIPRSTDPKAASALSFTMRLKTSFGDQTGFSSDTGWGCMIRSGQSLLANALLISQLGRDWRRTTDPGAERNIVALFADDARAPYSLQNFVKHGAIACGKHPGEWFGPSATARCIQALADQHESSLRIYSTGDLPDVYEDSFLATARPDGETFHPTLILVCTRLGIDKINPVYEEALISTLQMEQSIGIAGGRPSSSHYFVGVQRQWLFYLDPHHPRPALQYRENPLNYTLEELDSCHTRRLRYLHVEDMDPSMLIGFLIQDEDDWDMWKSAVKHVQGKSIINVSRHDPARGMGGARAEAIDEVETLSDDDDVDTVLEQ

ATG4

Cysteine protease ATG4

446 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

50.441 kDa

MNQPNPNKQPIVQSTSEQTSNEEVDTVLGRFTLFVKDLSNGLNGSQEVPPSQESVSEEAEVISRKIIVLGQTFDNFDNANDYIESKLWLSYRCGFEPIPKSIDGPQPIQFFPSIIFNRSTIYSNFANLKSLFDKENFTSDAGWGCMIRTSQNLLANTLLKLYPKNEPEIVKLFQDDTSSPFSIHNFIRVASLSPLHVKPGEWFGPNAASLSIKRLASELLQDQEIDGIKIPRVFISENSDLFDDEIRDVFAKEKNASVLILFPIRLGIDKVNSYYYNSIFHLLASKYSCGIAGGKPSSSFYFLGYEDTDLIYFDPHLPQVVETPINMDSYHTTNYNRLNISLLDPSMMIGILVTNIDEYIDFKTSCLDINNKIVHFHPHTLPVQQDSIINQSWEEVQDEEEEFINLNVSKIENEQQQEQGQSTDAPDEFIDIGNQSSSVVSVPSNV

atg4

Probable cysteine protease atg4

439 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of atg8 to reveal a C-terminal glycine. Atg8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent atg8-PE deconjugation performed also by atg4 is an important step required to delipidate atg8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Atg8 delipidation by atg4 also recycles atg8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated atg8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

48.742 kDa

MTAADLGRYKRFVQYFWDPEPTNDTASQSPIWCLGKEYPILEKSATSAITDSPPQEGHYLPAQSLPTNEVTTPPDSTVGSLESSSGSQNCDTANADGGWPSAFLDDFEAKIWLTYRSNFPAIAKSQDPKALSAMSLSVRLRSQLVDQGGFTSDTGWGCMIRSGQSLLANALLTLRMGREWRRGVSSNEERKILSLFADDPRAPYSIHKFVEHGASACGKHPGEWFGPSATARCIQALSNSQAKSELRVYITGDGSDVYEDKFMSIAKPNHSDFTPTLILVGTRLGLDKITPVYWEALKYSLQMPQSVGIAGGRPSSSHYFIGVQESDFFYLDPHQTRPALPYKDNVEDYTTEDIDSCHTRRLRRLHIKEMDPSMLIAFLIRDENDWNEWRRAVKEVQGKGVIHVADTDPASYGLGGERDGAIDEVETFDDDDDDTILDA

atg4

Probable cysteine protease atg4

439 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of atg8 to reveal a C-terminal glycine. Atg8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent atg8-PE deconjugation performed also by atg4 is an important step required to delipidate atg8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Atg8 delipidation by atg4 also recycles atg8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated atg8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

48.728 kDa

MTTVDIGRYKRLVQYFWDPEPTNNIASKSPIWCLGEEYLVSDKSSPSAVTESPPKEGGYLLAQSLSTTETTTPPDSTVGSLESSSEYDNCDTASTDGGWPTAFLDDFEAKIWLTYRSNFPAIAKSQDPKALSAMSLSVRLRSQLVDQGGFTSDTGWGCMIRSGQSLLANALLTLRMGREWRRGSSSNEERKILSLFADDPRAPYSIHKFVEHGASACGKHPGEWFGPSAAARCIQALTNSQVESELRVYITGDGSDVYEDTFMSIAKPNSTKFTPTLILVGTRLGLDKITPVYWEALKSSLQMPQSVGIAGGRPSSSHYFIGVQESDFFYLDPHQTRPALPFNDNVEDYTPEDIDSCHTRRLRRLHIKEMDPSMLIAFLIRDENDWKDWRRAVREVQGKGVIHVADRDPALHGLGAERDGAIDEVETFDDDDDDTVLNG

ATG4

Probable cysteine protease ATG4

432 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

49.088 kDa

MNTVDIGQKYKRIVEYLWDPEPKNDDDIIEPVWCLGKEYKTSIPRDSEGAEAPESCNMPGMPFLSPMNQMSLSSRDTQAALSKPATPPHQLGIQRSKSREWPTSFLDDFESKFWFTYRSNFPAIPKSRDPDTPLALTLSVRLRSQFLDTHGFTADTGWGCMIRSGQSLLANALSILNLGRDWRRGSKIKEECELLSLFADNPQAPFSIHRFVDYGASACGKHPGEWFGPSATARCIEALSNECKHTDLNVYVMSDGSDVHEDQFRQIAGPDGIRPTLILLGVRLGIESVTPVYWEALRAIIRYPQSVGIAGGRPSSSLYFIGVQGPYFFYLDPHHTRPAVSWNPDSTLSPENLDTYHTRRLRRLHIREMDPSMLIGFLIKDDDDWKDWKRRLRSVTGNPIIHIFDLERPNFGRHLEREEAVDEVEALDDDSN

ATG4

Probable cysteine protease ATG4

411 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

46.394 kDa

MELSQKEIGLDRSKDDNGLSSNDYVVLGIHYPIDSDDDKVVELANKRSNSAGGSIGMFQQFFNKVEEFDYHPGFLSDVISRIHFTYRTKFIPIARSDDGPSPLRINFLIGDNPFNAIENAIYNPNCFNTDIGWGCMIRTGQSLLANAIQIAILGREFRVNDGDVNEQERKIISWFMDTPDEPFSLHNFVKKGCELSSKKPGEWFGPAATSRSIQSLVEQFPDCGIDRCIVSVSSADIFKDEINDIFKNKRYSNILLLMGVKLGVDKVNEYYLKDIRKILESRYSVGISGGRPSSSLYFFGYQDDTLLYFDPHKPQPSTIESLLETCHTDNFDKINISDMDPSMLIGVLLQGEDDWQSWSNEVFDSKIINILNSRNDVTIAEDSMSLEETLEPPDNEYVDLGPMSQQLNGSP

atg4

Probable cysteine protease atg4

407 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of atg8 to reveal a C-terminal glycine. Atg8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent atg8-PE deconjugation performed also by atg4 is an important step required to delipidate atg8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Atg8 delipidation by atg4 also recycles atg8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated atg8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

45.512 kDa

MNSVDIGRCRKRIVQYIWDPEPRNDEEPDASIWCLGVEYAPQPQKITANTTPGKLGNYQDELEAGTSKIDDVTAHGWPEAFVSDFESKIWMTYRSDFPPIPRLDNDEANHPMTLTVRIRTQLMDPQGFTSDTGWGCMIRSGQSLLANAMLTLCLGRDWRRGDKAEEEARLLSLFADHPDAPLSIHRFVKYGAESCGKHPGEWFGPSATARCIEALSAQCGNIAPRVYVTNDTSDVYEDSFLRVARSGSGSIQPTLILLGTRLGIDNVTPVYWDGLKAVLQLPQSVGIAGGRPSASHYFIGTQGPHFFYLDPHTTRPAVPYSIDGRLLSKTEISTYHTRRLRRIHIQDMDPSMLIGFLVRNEDDWEDWKGRVGSVVGKQIIHVFKGEEATYNQGRRGALDEVEALDDA

atg4

Probable cysteine protease atg4

404 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of atg8 to reveal a C-terminal glycine. Atg8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent atg8-PE deconjugation performed also by atg4 is an important step required to delipidate atg8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Atg8 delipidation by atg4 also recycles atg8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated atg8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

45.818 kDa

MNTVDIGRCSKRIVQYLWDPEPRNDEDPNSSIWCLGIEYHPDKDANTRETPDKNNTRENVMGTTNYRKPSEHAWPESFLLDFESRIWMTYRSNFPPIPRVEGDDKSASMTLGVRLRSQLVDTQGFTSDTGWGCMIRSGQSLLANALSMLVLGRDWRRGARFEEESQLLSLFADTPTAPFSVHRFVKHGAESCGKYPGEWFGPSATAKCIEALSSQCGNPTLKVYVSNDTSEVYQDKFMDIARNTSGAFQPTLILLGTRLGIDNITPVYWDGLKAALQFPQSVGIAGGRPSASHYFVGAQGSHLFYLDPHYTRPALPDRQEGELYSKEEVDTYHTRRLRRIHVRDMDPSMLIGFLIRNQEDWADWLKRIEAVKGRPIIHVLKQMNPDHDQEAGALDQVEALDDIE

atg4

Cysteine protease atg4

402 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of atg8 to reveal a C-terminal glycine. Atg8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent atg8-PE deconjugation performed also by atg4 is an important step required to delipidate atg8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Atg8 delipidation by atg4 also recycles atg8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated atg8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

45.379 kDa

MNATDIERCRKRIIQYIWDPEPKNDEEPGSPIWCLGTRYPPQCVEETADESRNPDHGQQQNTNTSAPGWPEAFLLDFESKIWMTYRSNFPPIPKDAGQEGSLSLTLGVRLRSQLIDAQGFTSDTGWGCMIRSGQSLLANSMAILLLGRDWRRGERLEEEGKLLSLFADSPHAPFSIHSFVKHGADFCGKHPGEWFGPTATARCIQGLAARYDQSNLQVYIADDNSDVHQDKFMSVSRDEKGTVRPTLILLGLRLGIDRITAVYWNGLKAVLQLPQSVGIAGGRPSASHYFVAVQGSHFFYLDPHNTRPALRYSESGTYTEDEVNTYHTRRLRRLNIQDMDPSMLIGFLIRDEDDWEDWKARIMSLEGKPIITILSESDAASWKGRREALDEVEAFDDLDVAL

ATG4

Probable cysteine protease ATG4

402 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of ATG8 to reveal a C-terminal glycine. ATG8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent ATG8-PE deconjugation performed also by ATG4 is an important step required to delipidate ATG8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of ATG9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. ATG8 delipidation by ATG4 also recycles ATG8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated ATG8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

44.844 kDa

MTWDTKNQFETTKTSQELPATSQDHISDNKMNSEPSHRLSQFWSSLTRSSSESITAEPVVILGHTYREGDRDREGDSEVQKQVKKRYWMSYRSGFEPIKKHEDGPSPLSFVQSMIFNKNVGNTFANIHSLVDNDNFTTDVGWGCMIRTSQSVLANAIDRAGYEVDVELFADTSSAAFSLHNFVKVASDSPLRVRPGQWFGPSAASLSIKRLCEARNSSTNVPLSVLVCESGDIYDDQIQTFPVLLLLPLRLGIDHVNNVYHSSLLQLLEVPQSAGIAGGKPSSSLYFFGYQGTSLLYLDPHYPQNVSAGVGSYHSSSYQKLDISDMDPSMMAGIVLKNNEDYTDLKRRTTGNKIIHFHEARNYNDYVEVEREDFIDLGQNNRSATAGAEADFDSESSMVIVD

atg4

Probable cysteine protease atg4

401 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of atg8 to reveal a C-terminal glycine. Atg8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent atg8-PE deconjugation performed also by atg4 is an important step required to delipidate atg8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Atg8 delipidation by atg4 also recycles atg8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated atg8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

45.302 kDa

MTMDMEKCKRIVQYFWDPEPRNDVPAASIWCLGREYAPSQPPSDPASNNPRSPSRQPNASTLNDTTWPKAFLSDFGSRIWITYRSNFTPIPRTKTPEATSSMTLGVRLRSQLMDPQGFTSDTGWGCMIRSGQSLLANTFSVLLLGRDWRRGEKVEEESKLISMFADHPEAPFSIHRFVNRGAESCGKYPGEWFGPSATAKCIQLLSTQSEVPQLRVYLTNDTSDVYEDKFAHVAHDESGRIQPTLILIGTRLGIDNVTPAYWDGLRAALTYPQSVGIAGGRPSASHYFVGAQDCHLFFLDPHTTRPATLYRPDGLYTQEELDSYYTSRLRRIHIKDMDPSMLIGFLVKDEDDWADWKKRIRSTPGQPIVHIFPSQHQPDHGHGRAEALDEVEALDDSDEME

atg4

Probable cysteine protease atg4

400 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of atg8 to reveal a C-terminal glycine. Atg8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent atg8-PE deconjugation performed also by atg4 is an important step required to delipidate atg8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Atg8 delipidation by atg4 also recycles atg8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated atg8 that is required for autophagosome formation at the PAS (By similarity).

Belongs to the peptidase C54 family.

45.724 kDa

MNSVDIGRYKRIINYLWDPEPRNDLPDEPIWCLGIRYPPNHRGWKTQDQDGSAQGQYEQKTIPTEKANEHQWPEEFLDDVESRIWITYRSNFTPIPKPPNQEANPAMTLTVHLRSQLMDSQGFTSDTGWGCMIRSGQSLLANAMLILLLGRDWRRGTEAGKEAQLLHQFADHPEAPFSIHRFVQHGAEFCNKYPGEWFGPSATARCIQALVAQQGSSELRVYITDDTADIYEDKFARIAQAEHGDFIPTLILVGTRLGIDHVTPAYWDALKEALQLPQSVGIAGGRPSASHYFIGVHGQYLFYLDPHHTRPASLHQDVNDTLTHEEVNTYHTRRLRRIHIKDMDPSMLIGFIIRSREDWTDWKTRILSGRGNSIVHILSEDTANHQARKEAIDEVEALDD

atg4

Probable cysteine protease atg4

320 amino acids

Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Cleaves the C-terminal amino acid of atg8 to reveal a C-terminal glycine. Atg8 ubiquitin-like activity requires the exposure of the glycine at the C-terminus for its conjugation to phosphatidylethanolamine (PE) and its insertion to membranes, which is necessary for autophagy. The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy. Moreover not only conjugation, but also subsequent atg8-PE deconjugation performed also by atg4 is an important step required to delipidate atg8 to release the protein from membranes, which facilitates multiple events during macroautophagy, and especially for efficient autophagosome biogenesis, the assembly of atg9-containing tubulovesicular clusters into phagophores/autophagosomes, and for the disassembly of PAS-associated ATG components. Atg8 delipidation by atg4 also recycles atg8-PE generated on inappropriate membranes to maintain a reservoir of unlipidated atg8 that is required for autophagosome formation at the PAS (By similarity). Plays a role in meiosis and sporulation.

Belongs to the peptidase C54 family.

36.929 kDa

MELMARFLERYLHFAPTNTEPPGTLIWFLGHSYKIEDSQWPEKFLYDSFSLITITYRSGIEGLENMTSDTGWGCMIRSTQTLLANCLRICYPEKQLKEILALFADEPSAPFSIHQFVTMGKTLCDINPGQWFGPTTSCSCVARLSDQNPDVPLHVYVARNGNAIYRDQLSKVSFPVLLLIPTRLGIDSINESYYDQLLQVFEIRSFVGITGGRPRSAHYFYARQNQYFFYLDPHCTHFAHTTTQPASEETFHSATLRRVAIQDLDPCMIFGFLIRDEEEWHSFEANQKYFADIVQIFDSEPQPVETHDDFVLDENVEDHL