Arp1

Scytalone dehydratase-like protein Arp1

744 amino acids

Scytalone dehydratase-like protein; part of the Pks2 gene cluster that mediates the formation of infectious structures (appressoria), enabling these fungi to kill insects faster (PubMed:29958281). The product of the Pks2 gene cluster is different from the one of Pks1 and has still not been identified (PubMed:29958281).

Belongs to the scytalone dehydratase family.

81.966 kDa

MGWNQTFLFLAFAATAASSLVGSGTSLQLNGIDYFVSPFSQGKVTNGSVAINTRQNQLGFVPATVIAGDLYTESTLQSLFLNWSTVDDVWQPAFLETIFVFNFAKLTNKNHNYHDGVSSSVFPLQVTHKIPSGPYFLNVHTGEVHPAYRLYDDFAGAFTQSLLQRPDGRFQTLSAQVPAAASITIGVPSRLYFTKTEAKPLAGVRIGVKDIFSLAGVKKGCGNRAWYHLYPVANSTGTAMQNLIDKGAIIVGVQKTSQFANGETPTADWVDYHSPFNPRGDGYQDPATSSAGAGSSIASYEWLDLAVGSDTGGSIRGPATVQGIFGNRPSHGLVSLDNVMPLSPKLDTPGFLARDPCLWNAANAALYRDKYTFFGHQAPRYPKKLYLLDFPAGNTSHAPILQNFVTKLAKFLDTSPTNIDLNKEWERTRPTSAGDQSLAQLLNTTYAAIISKDQAKLVREPFYRDYAAVHDGRLPFVNPVPLARWTWGDSQPSSLLSDAVRNKTLFMDWFNGNILPPSSDPLTCSSGLLLHVNGSADFVSRNRYINPPVPPFGFSNSQISLFAETPDSVFPLGQVPVFSSITNNTEYLPVTIDVVAAKGFQLQRDWARLRAILAPALYVDYTKIGKEKWDAMSADDFMAMVSNDDFLGDPCVKTQHLIGATYWERVSESKVIGHHQLRAAHQVYTSPDLKTVKLRGHSHATNEHYYVKSNGVWKFAGLKPEVRWNEYKFEEVFKGSYTQSEKHS

Arp1

Scytalone dehydratase-like protein Arp1

446 amino acids

Scytalone dehydratase-like protein; part of the Pks2 gene cluster that mediates the formation of infectious structures (appressoria), enabling these fungi to kill insects faster (PubMed:29958281). The product of the Pks2 gene cluster is different from the one of Pks1 and has still not been identified (PubMed:29958281).

Belongs to the scytalone dehydratase family.

48.911 kDa

MQNLTDKGAIIFGVQKTSQFANGETATADWVDYHSPFNPRGDGYQDPATSSAGAGSSIASYEWLDLAAGSDTGGSIRGPAAVQGIFGNRPSHGLISLDNAMPLSPKLDTPGFLARDPYLWNAANAALYRENPLSRWSWGDSQPSSILSRNKTLFMNWFNENILPRSSDPLTCSSGLLLHVDGSAGFISRNGYINPPVPPFGFSNGQISVFAETPDSVFPLGQVPAFSSITNHTEYLPVTINVVAAKGCDVLIAKLAEDMVAAGILKVLKIGAGIEGGEILMRRYFVRDDGDEVMSRITSRGRLLFQDWDRLRGILAPTLYVDYTKIGKGKWEAMSADDFMAMVSNDDFLGDLCVKTQHLIGATSWERVSESKVVGHHQLRAAHQVYTSPDLKTVKLRGHSHATNEHYYVKSDGVWKFAGLKPEVRWNEHKFEEVFKGSYTQSEKHS

ARP1

60S ribosomal protein L3-1

389 amino acids

Belongs to the universal ribosomal protein uL3 family.

44.559 kDa

MSHRKFEHPRHGSLGFLPRKRANRHRGKVKAFPKDDQTKPCKFTAFMGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPAMVVVGVVAYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWAKSKKKAFTGYAKQYDSEDGKKGIQAQLEKMKKYATVIRVLAHTQIRKMKGLKQKKAHMMEIQINGGTIAQKVDFAYSFFEKQIPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRVTK

ARP1

Centractin

384 amino acids

Core component of the dynactin complex which assists cytoplasmic dynein by increasing its processivity and by regulation of its cargo binding (By similarity). The dynactin complex is required for the spindle translocation late in anaphase and is involved in a cell wall synthesis checkpoint. ARP1 forms the backbone filament of the dynactin rod structure and serves as the scaffold for the remaining subunits. Required for proper orientation of the mitotic spindle.

Belongs to the actin family. ARP1 subfamily.

42.995 kDa

MDQLSDSYALYNQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLEDSTRVYSNLM

arp1

Centractin

379 amino acids

Core component of the dynactin complex which assists cytoplasmic dynein by increasing its processivity and by regulation of its cargo binding. The dynactin complex is required for the spindle translocation late in anaphase and is involved in a cell wall synthesis checkpoint. Arp1 forms the backbone filament of the dynactin rod structure and serves as the scaffold for the remaining subunits. Required for proper orientation of the mitotic spindle (By similarity).

Belongs to the actin family. ARP1 subfamily.

42.793 kDa

MTVTEIFDNQPICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKDMFVGSEAQNLRGLLKIQRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPLANIRNKEKIAEYFYETLNVPALSFSLQPVLALYASARTTGIVLECGDGLTHSVPIYDGFSIPSAIQQEEIGGRDVTDYLQLQLRKSGHELVSSAEKEIVREIKEKCCYVASDFRSEIESWTEHKPQIHTYQLPDNQTITLGTECFSAPEVLFNPEMMGSEASGLHIQLFKSILLSDIDLRSTLYSNIVLSGGSTLLRGFGERFISELRAISGKKNQVKIYASPERMHNAWLGGSILASLSTFRRLLITSEEYKNDQNVIFRRRF

Arp1

Actin-related protein 1

376 amino acids

Belongs to the actin family. ARP1 subfamily.

42.719 kDa

MEPYDVVVNQPVVIDNGSGVIKAGFAGEHIPKCRFPNYIGRPKHVRVMAGALEGDIFVGPKAEEHRGLLSIRYPMEHGIVTDWNDMERIWSYIYSKEQLATFTEDHPVLLTEAPLNPRRNREKAAEFFFEGINAPALFVSMQAVLSLYATGRVTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVTRYLKTLIRREGFNFRSTAEFEIVRSIKEKVCYLATNPQKEETVETEKFAYKLPDGKIFEIGPARFRAPEVLFRPDLLGEECEGIHDVLMYSIEKSDMDLRKMLYQNIVLSGGSTLFKGFGDRLLSELKKHSAKDLKIRIAAPQERLYSTWMGGSILASLDTFKKMWISKREYEEEGQKAVHRKTF

ARP1

Probable RNA-binding protein ARP1

261 amino acids

Probable RNA-binding protein involved in the regulation of abscisic acid (ABA) response during seed germination. May regulate transcript levels of several germination-responsive genes under ABA.

28.857 kDa

MTTSNNVNGCFGDTKLTKVFVGGLAWDTHKEAMYDHFIKYGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGRRANCNLASLGGRLRKSPTMTSPQQGPKNGNRATPPHVGNHSQWYYPSGFTNQQHQQQNHQAVPFYGYPSAYVAPNMTFNQKVGYVGGTYMNGYYAQMQPQPQSQPQPQYYHHHMYGGGRVMVGAASPMVPFYTVYPYHQSQAIGFPQPSFSKPLSFSTPPISGTVGGESIQKKAIH

Arp1

Scytalone dehydratase-like protein Arp1

190 amino acids

Scytalone dehydratase-like protein; part of the Pks2 gene cluster that mediates the formation of infectious structures (appressoria), enabling these fungi to kill insects faster (PubMed:29958281). The product of the Pks2 gene cluster is different from the one of Pks1 and has still not been identified (PubMed:29958281).

Belongs to the scytalone dehydratase family.

21.729 kDa

MTQSSTPAVETDSKTGSSKAISFQDYLDLSKQAFHNQQPLHLLTQRISFQDWARLRAILAPALYVDYTKIGKEKWDAMSADDFMAMVSNDDFLGDPCVKTQHLIGATYWERVSESKVIGHHQLRAAHQVYTSPDLKTVKLRGHSHATNEHYYVKSGGVWKFAGLKPEVRWNEYKFEEVFKGSYTQSEKHS

Arp1

Scytalone dehydratase-like protein Arp1

174 amino acids

Scytalone dehydratase-like protein; part of the Pks2 gene cluster that mediates the formation of infectious structures (appressoria), enabling these fungi to kill insects faster (PubMed:29958281). The product of the Pks2 gene cluster is different from the one of Pks1 and has still not been identified (PubMed:29958281).

Belongs to the scytalone dehydratase family.

19.752 kDa

MAQSLTPSVETDSKTGPSKAISFQDYLDLSALDWARLRAVLAPTLYVDYTKIGKEKWDAMSADDFMAMVSNDDFLGDLCVKTQHLIGATYWERVSESKVIGHHQLRAAHQVYTSPDLKTVKLRGHSHATNEHYYVKSGGVWKFAGLKPEVRWNEYKFEEVFKGSYTQSEKQSLP

Arp1

Scytalone dehydratase-like protein Arp1

172 amino acids

Scytalone dehydratase-like protein; part of the Pks2 gene cluster that mediates the formation of infectious structures (appressoria), enabling these fungi to kill insects faster (PubMed:29958281). The product of the Pks2 gene cluster is different from the one of Pks1 and has still not been identified (PubMed:29958281).

Belongs to the scytalone dehydratase family.

19.566 kDa

MSQSLTSSVETDSKTGSSKAISFQDYLDLSALDWARLRAILAPTLYVDYTKIGKEKWDAMSADDFMAMVSNDDFLGDPCVKTQHLIGATYWERVSESKVIGHHQLRAAHQVYTSPDLKTVKLRGHSHATNEHYYVKSSGVWKFAGLKPEVRWNEYKFEEVFKGSYTQSEKQS

Arp1

Scytalone dehydratase-like protein Arp1

172 amino acids

Scytalone dehydratase-like protein; part of the Pks2 gene cluster that mediates the formation of infectious structures (appressoria), enabling these fungi to kill insects faster (PubMed:29958281). The product of the Pks2 gene cluster is different from the one of Pks1 and has still not been identified (PubMed:29958281).

Belongs to the scytalone dehydratase family.

19.512 kDa

MNQSLTPSAGTDSKTGSSKAISFQDYLDLSTLDWARLRAILAPALYVDYTKIGKEKWDAMSADDFMAMVSNDDFLGDPCVKTQHLIGATYWERVSESKVIGHHQLRAAHQVYTSPDLKTVKLRGHSHATNEHYYVKSSGVWKFAGLKPEVRWNEYKFEEVFKGSYTQSEKHS

arp1

Scytalone dehydratase arp1

168 amino acids

Scytalone dehydratase; part of the gene cluster that mediates the biosynthesis of dihydroxynaphthalene (DHN)-melanin, a bluish-green pigment and a structural component of the conidial wall (PubMed:10515939, PubMed:19156203). The first step of the pathway is the production of the heptaketide naphtopyrone YWA1 by the polyketide synthase alb1 though condensation of acetyl-CoA with malonyl-CoA (PubMed:10515939). The naphtopyrone YWA1 is then converted to the pentaketide 1,3,6,8-tetrahydroxynaphthalene (1,3,6,8-THN) by the heptaketide hydrolyase ayg1 though chain-length shortening (PubMed:10515939). 1,3,6,8-THN is substrate of the hydroxynaphthalene reductase arp2 to yield scytalone (PubMed:10515939). The scytalone dehydratase arp1 then reduces scytalone to 1,3,8-THN (PubMed:10515939). 1,3,8-THN is also substrate of the hydroxynaphthalene reductase arp2 to yield vermelone (PubMed:10515939). Vermelone is further converted by the multicopper oxidase abr1 to 1,8-DHN (PubMed:10515939). Finally the laccase abr2 transforms 1,8-DHN to DHN-melanin (PubMed:10515939). DHN-melanin biosynthesis appears to be initiated in endosomes where early enzymes (abl1, ayg1, arp1 and arp2) localize, with exocytosis leading to melanin deposition on the cell surface where late enzymes (abr1 and abr2) localize (PubMed:26972005). DHN-melanin is an important structural component of the outer cell wall and is required for the presence of conidial surface hydrophobins (PubMed:19703288). DHN-melanin plays also a crucial role in fungal virulence, including a protective role against the host's immune defenses (PubMed:19156203, PubMed:20145078, PubMed:21747802, PubMed:21573171, PubMed:24818666). DHN-melanin protects also conidia against amoeba predation (PubMed:25684622).

Belongs to the scytalone dehydratase family.

19.716 kDa

MVEKKPNLTLEFHDYLALKKVLFDWADSYDAKDWDRLRSIIAPTLTVDYRQIGLRKWDDMPAEDYMAMISDMDFLGDPTVKTQHLLGESWWEKISDTEVIGHHQLRAAHQVYTDSTLQTVKLKGHGHATNEHYYRKVDGVWKFAGLKPTVRWNEYQFEDVFRAAKPSV