ARAC4

Rac-like GTP-binding protein ARAC4

195 amino acids

Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation (By similarity). May be involved in cell polarity control during the actin-dependent tip growth of root hairs. May regulate a WAVE complex that activates the Arp2/3 complex.

Belongs to the small GTPase superfamily. Rho family.

21.636 kDa

MASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRCAFL