ANGPTL4

Angiopoietin-related protein 4

412 amino acids

ANGPTL4 N-terminal chain: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.

45.534 kDa

MRSAPTARAALVLCAATAGLLSAQGSPEPPEAPRFASWDEVNVLAHGLLQLGRGLREHVERTRGQLGALERRLSACGAACKDPEGSAVPPLTAGNLVPSQSDAAPETLHSLQTQLKAQNSKIQQLFQKVAQQQRHLEKQHLRIQNLQGQLDHLAPMHLGHGVAKAARRKRLPKMTQPAGPAHNISRLHRLPRDCQELFEEGERQSGLFQIQPQGSPPFLVNCKMTSDGGWTVIQRRQDGSVDFNQPWEAYKDGFGDPKGEFWLGLEKVHRIMGDRGSRLAVQLQDWEGNAESLQFPVHLGGEDTAYSLQLTAPVASKLGATIDTPSGLSLPFSTWDQDHDLRGDKNCAKILSGGWWFGTCSHSNLNGQYFHSIPRQREQRKKGIFWKTWRGRYYPLQATTMLIQPTVAEAAS

ANGPTL4

Angiopoietin-related protein 4

410 amino acids

ANGPTL4 N-terminal chain: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.

45.553 kDa

MRCAPTAGAALMLCAATAGLLSAQGRPEPPETPRFASWDEVNVLAHGLLQLGHGLREHVERTRGQLGELERRLGACGAACKDPEGSAAPPRAQANLVNPGGGDASPETLRSLKTQLEAQNSRIQQLFQKVAQQQRHLEKQQLRIQNLQSQMDHLAPRHLGHEMAKPARRKRLPKMAQLAGPAHNISRLHRLPRDCQELFEEGERESGLFQIQPQGSPPFLVNCKMTSDGGWTVIQRRQDGSVDFNQPWEAYKDGFGDPQGEFWLGLEKVHHILGDRGSRLAVQLQDWEGNAESLQFPIHLGGEDTAYSLQLTPPVASKLGATTFSPSGLSLPFSTWDQDHDLRGDKNCARSLSGGWWFGTCSHSNLNGQYFHSIPRQRQQRKKGIFWKTWRGRYYPLQATTILVQPTAAS

Angptl4

Angiopoietin-related protein 4

410 amino acids

ANGPTL4 N-terminal chain: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.

45.538 kDa

MRCAPTAGAALVLCAATAGLLSAQGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

ANGPTL4

Angiopoietin-related protein 4

406 amino acids

ANGPTL4 N-terminal chain: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism (PubMed:19270337, PubMed:21398697, PubMed:27929370, PubMed:29899144). Has higher activity in LPL inactivation than the uncleaved protein (PubMed:19270337, PubMed:21398697).

45.214 kDa

MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

Angptl4

Angiopoietin-related protein 4

405 amino acids

ANGPTL4 N-terminal chain: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.

44.951 kDa

MRCAPTAGAALVLCAATAGLLSAQGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGTDPKDRVPEGQAPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLTPTHLDNGVDKTSRGKRLPKMAQLIGLTPNATRLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGDRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQQRKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS