Function
Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating angiogenic signals mediated by ANGPT1. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal (By similarity).
Sequence
MWQLVFLTLSCDLAVATAHSGSRKGMDIAAGKKQYQVQHGACSYTFLLPETDHCRSPSSAYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEISKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVNNLLTLMSTSNPSYSLLAKDEQIIFRDCGEAFKSGLTTSGVYTLTFPNSTEEIKAYCDMETGGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVSQVTGQKRYVLKIHLRDWEGNEAYSLYDHFYLSNEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF