ANB1

Eukaryotic translation initiation factor 5A

158 amino acids

mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis (By similarity).

Belongs to the eIF-5A family.

17.132 kDa

MAEEDHTFETADAGAALTFPMQCSALRKNGHVVIKNRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPNVSRQEFQLLDIDDGYLSLMTADGDTKDDVKVPEGELGDKLQSEFDEGKDLIVTIISAMGEEAAISYKEAPKGSA

ANB1

Eukaryotic translation initiation factor 5A-2

157 amino acids

mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell (By similarity).

Belongs to the eIF-5A family.

17.131 kDa

MSDEEHTFENADAGASATYPMQCSALRKNGFVVIKGRPCKIVDMSTSKTGKHGHAKVHLVTLDIFTGKKLEDLSPSTHNLEVPFVKRSEYQLLDIDDGYLSLMTMDGETKDDVKAPEGELGDSMQAAFDEGKDLMVTIISAMGEEAAISFKEAPRSD