alt2

Cytochrome P450 monooxygenase alt2

537 amino acids

Cytochrome P450 monooxygenase; part of the gene cluster that mediates the biosynthesis of alternapyrone derivatives (PubMed:16356847). Alternapyrone is a decaketide with octa-methylation from methionine on every C2 unit except the third unit (PubMed:16356847). All the domains in the polyketide synthase alt5 are apparently involved in alternapyrone synthesis, that is, the 8 CMeT, 7 KR, 7 DH, and 4 ER reactions in the 9 KS-mediated condensation steps required for alternapyrone synthesis (PubMed:16356847). the alternapyrone produced by alt5 might be intensively modified by cytochrome P450 monooxygenases alt1, alt2 and alt3 and FAD-dependent oxidoreductase alt4 present in the alt gene cluster (PubMed:16356847).

Belongs to the cytochrome P450 family.

60.773 kDa

MQTHLLILAAVVLLIIHIVNNFLIKPLQTLLKSRRLGCGPVPFEPTRWPLDIDTIRRSLKADKEQRTPDFVAGRFETMGRYTWGLSLLGTSNLITAEPRNVQALLATQFDDFIMGTARRTNLKTALGRSIFAVDGKAWHRARETMRPIFSRENVSRLELLEEHVQTMLQIIETKDEGLTTDANDRAWSAPVSLAVLLPRLTMDSATELFLGQSTHSLKKALARQQQKSGNEEHDADSFDHAFERMLAILGTRMRLRSLYWLYGNKELQKCINALHAFVDSAIDAADQARKSGSSQLRYDFLETLRTRCSDRAEVREQVLGLLAAGRDTTASLTAWVFYCLVRNPRVYKKLRDTVLAEFGPYSTNPGQKITFEKLKGCTYLQHVLNETLRLHSVVPFNSRCAARDTTLPVGGGPDGSMPVFVPKGTEVNFSTHVLHRRKDLWGEDADEFVPERWEKKRPGMTWQYVPFNGGPRICIGQQFALTEAGYVLVRMVQRYDVIEGLDIDVERDWHNFTVVCSPGSPVARDAAVMCRLRVAVE

ALT2

Probable alanine aminotransferase

507 amino acids

Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily.

56.77 kDa

MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQDFFSKYRN

ALT2

Acyl-acyl carrier protein thioesterase ATL2, chloroplastic

188 amino acids

Acyl-ACP thioesterase involved in the production of fatty acids and beta-keto fatty acids. Can produce beta-keto fatty acids of medium chain (8:0 and 10:0) and small amounts of 8:0 fatty acid when expressed in a heterologous organism (E.coli). May play a role in suberin biosynthesis.

Belongs to the 4-hydroxybenzoyl-CoA thioesterase family.

21.325 kDa

MFQATSTGAQIMHAAFPRSWRRGHVLPLRSAKIFKPLACLELRGSTGIGGFHEIELKVRDYELDQFGVVNNAVYANYCQHGRHEFMDSIGINCNEVSRSGGALAIPELTIKFLAPLRSGCRFVVKTRISGISLVRIYFEQFIFKLPNQEPILEAKGTAVWLDNKYRPTRVPSHVRSYFGHFQCQHLVD