About Products Protein Database Contact

AKR1C8P

Gene
AKR1C8P
Protein
Putative aldo-keto reductase family 1 member C8
Organism
Homo sapiens
Length
129 amino acids
Similarity
Belongs to the aldo/keto reductase family.
Mass
14.588 kDa
Sequence
MMTDLKQSHSVRLNDGPFMPVLGFGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKREEIFYTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIHVPFAMKGSS